Two pore calcium channel protein 2 Antibody - BSA Free

Staining of human duodenum shows strong membranous positivity in glandular cells.

Staining of human placenta shows strong membranous positivity in trophoblastic cells.

Staining of human liver shows moderate membranous positivity in hepatocytes.

Staining of human kidney shows strong membranous positivity in cells in glomeruli.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Two pore calcium channel protein 2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QFRGYLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGAFPQAVGVKPQNLLQVLQKVQLDSSHRQAMMEKVRSYGSVLLSAEEFQKLFNELDRSVVKEHPPRPEYQSPFLQSAQFLFGHYYF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TPCN2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reported in scientific literature (PMID: 29993362)
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Two pore calcium channel protein 2 Protein (NBP1-86923PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Two pore calcium channel protein 2 Antibody - BSA Free

• FLJ41094
• SHEP10
• TPC2
• TPC2two pore calcium channel protein 2
• TPCN2
• Two pore calcium channel protein 2
• two pore segment channel 2
• two-pore calcium channel protein 2
• Voltage-dependent calcium channel protein TPC2

Background

Function: May function as one of the major voltage-gated Ca2+ channel (VDCC) across the plasma membrane.; Subcellular location: Membrane; Multi-pass membrane protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Two pore calcium channel protein 2 Antibody (NBP1-86923)(1)

Publication using NBP1-86923

• Lin J. R, Izar B, et al. Highly multiplexed immunofluorescence imaging of human tissues and tumors using t-CyCIF and conventional optical microscopes. Elife 2018-07-11 [PMID: 29993362] (ICC/IF, Human)
  
  Details:
  Citation using the Alexa Fluor 488 format of this antibody.

FAQs for Two pore calcium channel protein 2 Antibody (NBP1-86923). (Showing 1 - 1 of 1 FAQ).

1. Can this antibody be used to label TPC2 in zebrafish?
   • We have only tested this antibody for use with human. I have carried out a blast to find that the percentage homology between the human protein and zebrafish protein is only 55%. I would not recommend this for use as our lab only recommends use if the homology is 85% or above.

Bioinformatics

• Gene Symbol: TPCN2