TWF2 Antibody

Images

 
Western Blot: TWF2 Antibody [NBP1-98388] - HepG2 Cell Lysate 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TWF2 Antibody Summary

Immunogen
The immunogen for this antibody is TWF2 - N-terminal region. Peptide sequence MAHQTGIHATEELKEFFAKARAGSVRLIKVVIEDEQLVLGASQEPVGRWD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TWF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control
TWF2 Lysate (NBP2-65679)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TWF2 Antibody

  • A6-related protein
  • A6RPFLJ56277
  • hA6RP
  • protein tyrosine kinase 9-like (A6-related protein)
  • Protein tyrosine kinase 9-like
  • PTK9L protein tyrosine kinase 9-like (A6-related protein)
  • PTK9LA6r
  • twinfilin, actin-binding protein, homolog 2 (Drosophila)
  • Twinfilin-1-like protein
  • twinfilin-2

Background

The protein encoded by this gene was identified by its interaction with the catalytic domain of protein kinase C-zeta. The encoded protein contains an actin-binding site and an ATP-binding site. It is most closely related to twinfilin (PTK9), a conserved actin monomer-binding protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90297
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF3966
Species: Hu
Applications: WB, IHC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for TWF2 Antibody (NBP1-98388) (0)

There are no publications for TWF2 Antibody (NBP1-98388).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TWF2 Antibody (NBP1-98388) (0)

There are no reviews for TWF2 Antibody (NBP1-98388). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TWF2 Antibody (NBP1-98388) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TWF2 Antibody (NBP1-98388)

Discover related pathways, diseases and genes to TWF2 Antibody (NBP1-98388). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TWF2 Antibody (NBP1-98388)

View related products by pathway.

PTMs for TWF2 Antibody (NBP1-98388)

Learn more about PTMs related to TWF2 Antibody (NBP1-98388).
 

Research Areas for TWF2 Antibody (NBP1-98388)

Find related products by research area.

Blogs on TWF2

There are no specific blogs for TWF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TWF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TWF2
Uniprot