TWF2 Antibody


Western Blot: TWF2 Antibody [NBP1-98388] - HepG2 Cell Lysate 1.0ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

TWF2 Antibody Summary

The immunogen for this antibody is TWF2 - N-terminal region. Peptide sequence MAHQTGIHATEELKEFFAKARAGSVRLIKVVIEDEQLVLGASQEPVGRWD.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
TWF2 Lysate (NBP2-65679)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TWF2 Antibody

  • A6-related protein
  • A6RPFLJ56277
  • hA6RP
  • protein tyrosine kinase 9-like (A6-related protein)
  • Protein tyrosine kinase 9-like
  • PTK9L protein tyrosine kinase 9-like (A6-related protein)
  • PTK9LA6r
  • twinfilin, actin-binding protein, homolog 2 (Drosophila)
  • Twinfilin-1-like protein
  • twinfilin-2


The protein encoded by this gene was identified by its interaction with the catalytic domain of protein kinase C-zeta. The encoded protein contains an actin-binding site and an ATP-binding site. It is most closely related to twinfilin (PTK9), a conserved actin monomer-binding protein.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for TWF2 Antibody (NBP1-98388) (0)

There are no publications for TWF2 Antibody (NBP1-98388).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TWF2 Antibody (NBP1-98388) (0)

There are no reviews for TWF2 Antibody (NBP1-98388). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TWF2 Antibody (NBP1-98388) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for TWF2 Antibody (NBP1-98388)

Discover related pathways, diseases and genes to TWF2 Antibody (NBP1-98388). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TWF2 Antibody (NBP1-98388)

View related products by pathway.

PTMs for TWF2 Antibody (NBP1-98388)

Learn more about PTMs related to TWF2 Antibody (NBP1-98388).

Research Areas for TWF2 Antibody (NBP1-98388)

Find related products by research area.

Blogs on TWF2

There are no specific blogs for TWF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TWF2 Antibody and receive a gift card or discount.


Gene Symbol TWF2