Reactivity | HuSpecies Glossary |
Applications | ICC/IF |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Format | BSA Free |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: WQAHQRPGTRAEGESDSQDMGDAHKSPNMGPNPGMDGDCVYENLAFQKEEDLEKKREASESTGTNSSAAH |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | TULP2 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS, pH 7.2, 40% glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TULP2 Antibody (NBP3-21392)Find related products by research area.
|
Can Tubby Make You Tubby? The TUB gene, which encodes for the protein Tubby, is evolutionarily conserved in human, chimpanzee, dog, cow, mouse, chicken, zebrafish, fruit fly, mosquito, C. elegans, and rice. The gene derives its name from its role in metabolism; mice with a m... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | TULP2 |