Recombinant Human Tubby Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Tubby Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 439-538 of Human TUB partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KMSVIVPGMNMVHERVSIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TUB
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Tubby Protein

  • rd5
  • tubby (mouse) homolog
  • tubby homolog (mouse)
  • tubby homologue
  • tubby protein homolog

Background

TUB - tubby homolog (mouse)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP2-52559
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
H00000072-D01P
Species: Hu
Applications: WB
NBP1-89278
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009457-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NBP2-01671
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56490
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
AF497
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-59677
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47914
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-20849
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for Tubby Partial Recombinant Protein (H00007275-Q01) (0)

There are no publications for Tubby Partial Recombinant Protein (H00007275-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tubby Partial Recombinant Protein (H00007275-Q01) (0)

There are no reviews for Tubby Partial Recombinant Protein (H00007275-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Tubby Partial Recombinant Protein (H00007275-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Tubby Products

Bioinformatics Tool for Tubby Partial Recombinant Protein (H00007275-Q01)

Discover related pathways, diseases and genes to Tubby Partial Recombinant Protein (H00007275-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tubby Partial Recombinant Protein (H00007275-Q01)

Discover more about diseases related to Tubby Partial Recombinant Protein (H00007275-Q01).
 

Pathways for Tubby Partial Recombinant Protein (H00007275-Q01)

View related products by pathway.

PTMs for Tubby Partial Recombinant Protein (H00007275-Q01)

Learn more about PTMs related to Tubby Partial Recombinant Protein (H00007275-Q01).

Blogs on Tubby.

Auditory Infographic: Can you hear me now?
The auditory process involves several structures of the ear to convert sound waves into information that is processed by our brain. Learn more about the auditory process in our infographic below.Novus Biologicals offers reagents mentioned in the i...  Read full blog post.

Can Tubby Make You Tubby?
The TUB gene, which encodes for the protein Tubby, is evolutionarily conserved in human, chimpanzee, dog, cow, mouse, chicken, zebrafish, fruit fly, mosquito, C. elegans, and rice. The gene derives its name from its role in metabolism; mice with a m...  Read full blog post.

Customers Who Bought This Also Bought

Tubby Antibody
NBP2-20758

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Tubby Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TUB