Home » TTDN1 » TTDN1 Proteins » Recombinant Human TTDN1 Protein

Recombinant Human TTDN1 Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human TTDN1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 179 of Human C7orf11 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYGPRSRPYGSSHSPRHGGSFPGGRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKGRYFC
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
MPLKIP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
45.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TTDN1 Protein

  • ABHS
  • chromosome 7 open reading frame 11
  • ORF20
  • Russell-Silver syndrome region
  • TTD non-photosensitive 1 protein
  • TTDN1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

GTF2H5
Overexpression Lysate
NBL1-11392
Western Blot: GTF2H5 Overexpression Lysate (Adult Normal) [NBL1-11392] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for GTF2H5.
Species: Hu
XPB Antibody
AF6349
Western blot shows lysates of Daudi human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, MOLT‑4 human acute lymphoblastic leukemia cell line, NRK rat normal kidney cell line, and RAW 264.7 mouse monocyte/macrophage cell line. PVDF Membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat XPB Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6349) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for XPB at approximately 86 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
GTF2H4 Antibody
H00002968-B01P
Western Blot: GTF2H4 Antibody [H00002968-B01P] - Analysis of GTF2H4 expression in transfected 293T cell line by GTF2H4 polyclonal antibody. Lane 1: GTF2H4 transfected lysate(50.82 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: GTF2H4 Antibody [H00002968-B01P] - Analysis of purified antibody to GTF2H4 on HeLa cell. (antibody concentration 10 ug/ml)
Species: Hu
Applications: WB, ICC/IF
GTF2H2 Antibody
NBP2-56841
Western Blot: GTF2H2 Antibody [NBP2-56841] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/Immunofluorescence: GTF2H2 Antibody [NBP2-56841] - Staining of human cell line U-251 MG shows localization to nuclear speckles.
Species: Hu
Applications: WB, ICC/IF
GTF2H3 Antibody
NBP2-30371
Immunocytochemistry/Immunofluorescence: GTF2H3 Antibody [NBP2-30371] - Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm.
Immunohistochemistry: GTF2H3 Antibody [NBP2-30371] - Staining of human kidney shows strong cytoplasmic, membranous and nuclear positivity in cells in tubules.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
GTF2H1 Antibody
NBP2-38556
Western Blot: GTF2H1 Antibody [NBP2-38556] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunocytochemistry/Immunofluorescence: GTF2H1 Antibody [NBP2-38556] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GTF2H1 Antibody [NBP2-38556] - Staining of human testis shows high expression.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
CDC2/CDK1 Antibody
NBP1-85729
Western Blot: CDC2/CDK1 Antibody [NBP1-85729] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: CDC2/CDK1 Antibody [NBP1-85729] - Staining of human cell line U-251 MG shows localization to nucleus & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CDC2/CDK1 Antibody [NBP1-85729] - Staining in human tonsil and pancreas tissues. Corresponding CDK1 RNA-seq data are presented for the same tissues.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Claudin-3 Antibody
(385021) [Unconjugate ...
MAB4620
Claudin‑3 was detected in immersion fixed paraffin-embedded sections of human colon array using Mouse Anti-Human Claudin‑3 Monoclonal Antibody (Catalog # MAB4620) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
PC‑3 human prostate cancer cell line was stained with Mouse Anti-Human Claudin‑3 Monoclonal Antibody (Catalog # MAB4620, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (Catalog # F0102B).
Claudin‑3 was detected in immersion fixed PC‑3 human prostate cancer cell line using Mouse Anti-Human Claudin‑3 Monoclonal Antibody (Catalog # MAB4620) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
PLK1 Antibody
NB100-547
Western Blot: PLK1 Antibody [NB100-547] - Detection of Human PLK1 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-PLK1 antibody NB100-547 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunocytochemistry/Immunofluorescence: PLK1 Antibody [NB100-547] - Asynchronous HeLa cells. Antibody used at 0.5 ug/ml (left panel) and 0.2 ug/ml (right panel). Cells were counterstained with DAPI.
Western Blot: PLK1 Antibody [NB100-547] - Detection of Human PLK1 on HeLa whole cell lysate using NB100-547. B. Affinity purified rabbit anti-PLK1 antibodies NB100-546, NB100-547, and NB100-548. IPed PLK1 was detected using NB100-548.
Species: Hu
Applications: WB, ICC/IF, IP, PLA, ICC, IF
DERP13 Antibody
NBP1-84271
Immunohistochemistry-Paraffin: DERP13 Antibody [NBP1-84271] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: DERP13 Antibody [NBP1-84271] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: DERP13 Antibody [NBP1-84271] - Staining in human kidney and endometrium tissues using anti-SUGCT antibody. Corresponding SUGCT RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
DNA Polymerase
delta, catalytic subu ...
NBP2-33466
Western Blot: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining in human lymph node and liver tissues using anti-POLD1 antibody. Corresponding POLD1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
XPD Antibody
AF3296
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line, CH-1 mouse B cell lymphoma cell line, and Rat-2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Human/Mouse/Rat XPD Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3296) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for XPD at approximately 100 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
Exosome component
10 Antibody
NBP1-32870
Western Blot: Exosome component 10 Antibody [NBP1-32870] - analysis of EXOSC10 in HeLa whole cell extracts treated with (1) si-control and (2) EXOSC10 siRNA using anti-EXOSC10 antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-32870] - Paraffin-embedded Cal27 xenograft, using antibody at 1:100 dilution.
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Sample: 1000 ug 293T whole cell lysate/extract A. 30 ug 293T whole cell lysate/extract, B. Control with 2. 5 ug of preimmune rabbit IgG, C. Immunoprecipitation of EXOSC 10 protein by 2. 5 ug of EXOSC 10 antibody 7. 5% SDS-PAGE gel.
(2 Reviews)
(3 Publications)
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
RPLP2 Antibody
NBP2-15104
Western Blot: RPLP2 Antibody [NBP2-15104] - Sample (30 ug of whole cell lysate) A: 293T 15% SDS PAGE diluted at 1:10000 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: RPLP2 Antibody [NBP2-15104] - Analysis of methanol-fixed A431, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: RPLP2 Antibody [NBP2-15104] - Paraffin-embedded Colon ca, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

FABP8/M-FABP/Myelin P2
AF5866
Western blot shows lysates of human hippocampal and rat spinal cord tissue. PVDF membrane was probed with 1 µg/mL of Human FABP8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5866) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for FABP8 at approximately 15 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 7.
FABP8 was detected in immersion fixed paraffin-embedded sections of human spinal cord using 15 µg/mL Human FABP8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5866) overnight at 4 °C. Tissue was stained with the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
FABP8 was detected in immersion fixed paraffin-embedded sections of human brain (cortex) using Human FABP8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5866) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC
GEN1 Antibody
NBP2-30783
Western Blot: GEN1 Antibody [NBP2-30783] - Analysis in human cell line RH-30.
Immunocytochemistry/Immunofluorescence: GEN1 Antibody [NBP2-30783] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: GEN1 Antibody [NBP2-30783] - Staining of human kidney shows membranous positivity in cells in tubules.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
RFC2 Antibody
(OTI2B2)
NBP2-45570
Western Blot: RFC2 Antibody (2B2) [NBP2-45570] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RFC2.
Immunohistochemistry: RFC2 Antibody (2B2) [NBP2-45570] - Analysis of Adenocarcinoma of Human endometrium tissue.
Flow Cytometry: RFC2 Antibody (2B2) [NBP2-45570] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostained by RFC2 antibody.
Species: Hu
Applications: WB, Flow, IHC
RFC1 Antibody
NB100-230
Western Blot: RFC1 Antibody [NB100-230] - Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-RFC1 antibody (lot was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Western Blot: RFC1 Antibody [NB100-230] - Samples: Whole cell lysate (50, 15 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-RFC1 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Proximity Ligation Assay: RFC1 Antibody [NB100-230] - Secondary-conjugate Duolink II PLA in Hela cells. goat anti-human RFC1 (NB100-230) and rabbit anti-human RPA2 (NB100-332). Image merged from DAPI (2ms) and Texas Red (200ms) exposures, 40X magnification.
Species: Hu
Applications: WB, IP, PLA

Publications for TTDN1 Recombinant Protein (H00136647-P01) (0)

There are no publications for TTDN1 Recombinant Protein (H00136647-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTDN1 Recombinant Protein (H00136647-P01) (0)

There are no reviews for TTDN1 Recombinant Protein (H00136647-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TTDN1 Recombinant Protein (H00136647-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TTDN1 Products

Bioinformatics Tool for TTDN1 Recombinant Protein (H00136647-P01)

Discover related pathways, diseases and genes to TTDN1 Recombinant Protein (H00136647-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TTDN1 Recombinant Protein (H00136647-P01)

View related products by pathway.

PTMs for TTDN1 Recombinant Protein (H00136647-P01)

Learn more about PTMs related to TTDN1 Recombinant Protein (H00136647-P01).

Blogs on TTDN1

There are no specific blogs for TTDN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

12.5% SDS-PAGE Stained with Coomassie Blue.
Recombinant Human TTDN1 Protein
H00136647-Q01-10ug
Western Blot: Exosome component 10 Antibody [NBP1-32870] - analysis of EXOSC10 in HeLa whole cell extracts treated with (1) si-control and (2) EXOSC10 siRNA using anti-EXOSC10 antibody. Image from verified customer review.
Exosome component 10 Antibody
NBP1-32870
Western Blot: TTDN1 Antibody [NBP2-31718] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line HEK 293
TTDN1 Antibody
NBP2-31718
Western Blot: PLK1 Antibody [NB100-547] - Detection of Human PLK1 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-PLK1 antibody NB100-547 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
PLK1 Antibody
NB100-547

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TTDN1 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol MPLKIP