Recombinant Human TTDN1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TTDN1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 80 - 179 of Human C7orf11 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKGRYFC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MPLKIP

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TTDN1 Protein

  • ABHS
  • chromosome 7 open reading frame 11
  • ORF20
  • Russell-Silver syndrome region
  • TTD non-photosensitive 1 protein
  • TTDN1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-11392
Species: Hu
AF6349
Species: Hu, Mu, Rt
Applications: WB
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB4620
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-84270
Species: Hu
Applications: IHC, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3296
Species: Hu, Mu, Rt
Applications: WB
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-30783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA

Publications for TTDN1 Partial Recombinant Protein (H00136647-Q01) (0)

There are no publications for TTDN1 Partial Recombinant Protein (H00136647-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTDN1 Partial Recombinant Protein (H00136647-Q01) (0)

There are no reviews for TTDN1 Partial Recombinant Protein (H00136647-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TTDN1 Partial Recombinant Protein (H00136647-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TTDN1 Products

Bioinformatics Tool for TTDN1 Partial Recombinant Protein (H00136647-Q01)

Discover related pathways, diseases and genes to TTDN1 Partial Recombinant Protein (H00136647-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TTDN1 Partial Recombinant Protein (H00136647-Q01)

View related products by pathway.

PTMs for TTDN1 Partial Recombinant Protein (H00136647-Q01)

Learn more about PTMs related to TTDN1 Partial Recombinant Protein (H00136647-Q01).

Blogs on TTDN1

There are no specific blogs for TTDN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TTDN1 Antibody
NBP2-31718
PLK1 Antibody
NB100-547

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TTDN1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MPLKIP