Recombinant Human TSPYL1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TSPYL1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human TSPYL1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSGLDGVKRTTPLQTHSIIISDQVPSDQDAHQYLRLRDQSEATQVMAEPGEGGSETVALPPPPPSEEGGVPQDAAGRGGTPQIRVVGGRGHVAIKAGQEE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TSPYL1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TSPYL1 Protein

  • SIDDT
  • testis-specific Y-encoded-like protein 1
  • TSPY-like 1
  • TSPY-like protein 1
  • TSPY-like
  • TSPYLtestis-specific-like protein, Y encoded

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41198
Species: Hu, Mu
Applications: WB, ELISA
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
PP-H7431-00
Species: Hu
Applications: WB
AF475
Species: Mu
Applications: WB, IHC
NBP1-33415
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00057492-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF196
Species: Mu
Applications: WB, IHC
NBP1-84530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84071
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
H00058524-R01
Species: Hu
AF1408
Species: Hu, Rt
Applications: WB, Simple Western, IHC, IP
AF3075
Species: Hu
Applications: WB, ICC
AF1286
Species: Hu
Applications: WB, Simple Western, IHC, IP
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-32964
Species: Hu
Applications: Flow, ICC/IF, IHC-Fr
NBP1-86114
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007259-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TSPYL1 Partial Recombinant Protein (H00007259-Q01) (0)

There are no publications for TSPYL1 Partial Recombinant Protein (H00007259-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSPYL1 Partial Recombinant Protein (H00007259-Q01) (0)

There are no reviews for TSPYL1 Partial Recombinant Protein (H00007259-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSPYL1 Partial Recombinant Protein (H00007259-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TSPYL1 Products

Bioinformatics Tool for TSPYL1 Partial Recombinant Protein (H00007259-Q01)

Discover related pathways, diseases and genes to TSPYL1 Partial Recombinant Protein (H00007259-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSPYL1 Partial Recombinant Protein (H00007259-Q01)

Discover more about diseases related to TSPYL1 Partial Recombinant Protein (H00007259-Q01).
 

Pathways for TSPYL1 Partial Recombinant Protein (H00007259-Q01)

View related products by pathway.

Blogs on TSPYL1

There are no specific blogs for TSPYL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TSPYL1 Antibody
NBP2-38191
ATRX Antibody
NBP1-83077

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TSPYL1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TSPYL1