TSPEAR Antibody

Images

 
Western Blot: TSPEAR Antibody [NBP2-83716] - Host: Rabbit. Target Name: TSEAR. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TSPEAR Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TSPEAR. Peptide sequence: YDWEFFSVGPYSFLVVANTFNGTSTKVHSHLYIRLLGSFQLFQSFPTFGA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
TSPEAR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TSPEAR Antibody

  • C21orf29
  • Chromosome 21 Open Reading Frame 29
  • Deafness, Autosomal Recessive 98
  • DFNB98
  • Thrombospondin Type Laminin G Domain And EAR Repeats
  • Thrombospondin-Type Laminin G Domain And EAR Repeat-Containing Protein
  • Thrombospondin-Type Laminin G Domain And EAR Repeats-Containing Protein
  • TSP-EAR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-77342
Species: Hu
Applications: PEP-ELISA, WB
H00009211-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-56991
Species: Hu
Applications: WB
NBP2-57048
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7334
Species: Hu
Applications: ICC, WB
NB110-81601
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-01245
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DCLU00
Species: Hu
Applications: ELISA
NB110-68133
Species: Hu
Applications: IHC, IHC-P, WB
DTSP10
Species: Hu
Applications: ELISA
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
NBP2-83716
Species: Hu
Applications: WB

Publications for TSPEAR Antibody (NBP2-83716) (0)

There are no publications for TSPEAR Antibody (NBP2-83716).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSPEAR Antibody (NBP2-83716) (0)

There are no reviews for TSPEAR Antibody (NBP2-83716). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSPEAR Antibody (NBP2-83716) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TSPEAR Products

Bioinformatics Tool for TSPEAR Antibody (NBP2-83716)

Discover related pathways, diseases and genes to TSPEAR Antibody (NBP2-83716). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSPEAR Antibody (NBP2-83716)

Discover more about diseases related to TSPEAR Antibody (NBP2-83716).
 

Pathways for TSPEAR Antibody (NBP2-83716)

View related products by pathway.

Blogs on TSPEAR

There are no specific blogs for TSPEAR, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSPEAR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TSPEAR