TRRAP Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRRAP. Source: E. coli Amino Acid Sequence: TWVQLFPRLWKILSDRQQHALAGEISPFLCSGSHQVQRDCQPSALNCFVEAMSQCVPPIPIRPCVLKYLGKTHNLWFRSTLMLEHQ Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
TRRAP |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58076. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for TRRAP Recombinant Protein Antigen
Background
The novel ATM-related protein TRRAP is an essential cofactor for the c-Myc and E2F oncoproteins. It is an adapter protein, which is found in various multiprotein chromatin complexes with histone acetyltransferase activity (HAT), which gives a specific tag for epigenetic transcription activation. TRRAP plays a central role in MYC (c-Myc) transcription activation, and also participates in cell transformation by MYC. It is required for TP53/p53-, E2F1- and E2F4-mediated transcription activation. It most likely acts by linking transcription factors such as E1A, MYC or E2F1 to HAT complexes such as STAGA thereby allowing transcription activation and it is probably not required in the steps following histone acetylation in processes of transcription activation. TRRAP may also be required for the mitotic checkpoint and normal cell cycle progression.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Bv, Ch, Ha, Hu, Mu, Rt
Applications: ICC, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, , WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
Species: Hu
Applications: WB
Publications for TRRAP Recombinant Protein Antigen (NBP2-58076PEP) (0)
There are no publications for TRRAP Recombinant Protein Antigen (NBP2-58076PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TRRAP Recombinant Protein Antigen (NBP2-58076PEP) (0)
There are no reviews for TRRAP Recombinant Protein Antigen (NBP2-58076PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for TRRAP Recombinant Protein Antigen (NBP2-58076PEP) (0)
Additional TRRAP Products
Research Areas for TRRAP Recombinant Protein Antigen (NBP2-58076PEP)
Find related products by research area.
|
Blogs on TRRAP