Troponin C (cardiac) Antibody (1F8-A9)

Images

 
Western Blot: Troponin C (cardiac) Antibody (1F8-A9) [H00007134-M01] - Analysis of TNNC1 expression in transfected 293T cell line by TNNC1 monoclonal antibody (M01), clone 1F8-A9.Lane 1: TNNC1 transfected lysate(18.4 ...read more
Immunohistochemistry-Paraffin: Troponin C (cardiac) Antibody (1F8-A9) [H00007134-M01] - Analysis of monoclonal antibody to TNNC1 on formalin-fixed paraffin-embedded human heart. Antibody concentration 3 ug/ml.
ELISA: Troponin C (cardiac) Antibody (1F8-A9) [H00007134-M01] - Detection limit for recombinant GST tagged TNNC1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
1F8-A9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Troponin C (cardiac) Antibody (1F8-A9) Summary

Immunogen
TNNC1 (AAH30244, 1 a.a. - 161 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Localization
Cytoplasmic
Specificity
TNNC1 - troponin C, slow
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TNNC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Troponin C (cardiac) Antibody (1F8-A9)

  • cardiac troponin C
  • CMD1Z
  • CMH13
  • slow twitch skeletal/cardiac muscle troponin C
  • TNC
  • TN-C
  • TNNC
  • troponin C type 1 (slow)
  • troponin C, slow skeletal and cardiac muscles
  • troponin C, slow
  • troponin C1, slow

Background

Troponin I is part of a heteromeric complex playing an important role in the regulation of skeletal and cardiac muscle contraction. It consists of three subunits, troponin I (TnI), troponin T (TnT) and troponin C (TnC). Each subunit is responsible for part of troponin complex function. TnI inhibits ATPase activity of acto myosin and TnT and TnI are present in cardiac muscles in different forms than in skeletal muscles. Only one tissue specific isoform of TnI is described for cardiac muscle tissue (cTnI) and this is expressed only in myocardium.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32748
Species: Hu, Po
Applications: WB, IHC, IHC-P
NB110-2546
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Fi, Gt, Rb
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF6999
Species: Hu
Applications: WB, Simple Western, IHC
NB100-56146
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF3865
Species: Hu
Applications: WB, IHC
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00007134-M01
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for Troponin C (cardiac) Antibody (H00007134-M01) (0)

There are no publications for Troponin C (cardiac) Antibody (H00007134-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Troponin C (cardiac) Antibody (H00007134-M01) (0)

There are no reviews for Troponin C (cardiac) Antibody (H00007134-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Troponin C (cardiac) Antibody (H00007134-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Troponin C (cardiac) Products

Bioinformatics Tool for Troponin C (cardiac) Antibody (H00007134-M01)

Discover related pathways, diseases and genes to Troponin C (cardiac) Antibody (H00007134-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Troponin C (cardiac) Antibody (H00007134-M01)

Discover more about diseases related to Troponin C (cardiac) Antibody (H00007134-M01).
 

Pathways for Troponin C (cardiac) Antibody (H00007134-M01)

View related products by pathway.

PTMs for Troponin C (cardiac) Antibody (H00007134-M01)

Learn more about PTMs related to Troponin C (cardiac) Antibody (H00007134-M01).
 

Research Areas for Troponin C (cardiac) Antibody (H00007134-M01)

Find related products by research area.

Blogs on Troponin C (cardiac)

There are no specific blogs for Troponin C (cardiac), but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Troponin C (cardiac) Antibody (1F8-A9) and receive a gift card or discount.

Bioinformatics

Gene Symbol TNNC1
Entrez
OMIM
Uniprot