Tropomodulin 2 Antibody (5E7G5)

Western Blot: Tropomodulin 2 Antibody (5E7G5) [NBP3-15905] - Western blot analysis of extracts of various cell lines, using Tropomodulin 2 Rabbit mAb (NBP3-15905) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.

Immunohistochemistry-Paraffin: Tropomodulin 2 Antibody (5E7G5) [NBP3-15905] - Immunohistochemistry of paraffin-embedded mouse brain using Tropomodulin 2 Rabbit mAb (NBP3-15905) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: Tropomodulin 2 Antibody (5E7G5) [NBP3-15905] - Immunohistochemistry of paraffin-embedded rat brain using Tropomodulin 2 Rabbit mAb (NBP3-15905) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunocytochemistry/ Immunofluorescence: Tropomodulin 2 Antibody (5E7G5) [Tropomodulin 2] - Confocal imaging of paraffin-embedded Rat brain tissue using Tropomodulin 2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 5E7G5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Tropomodulin 2 Antibody (5E7G5) Summary

• Description: Novus Biologicals Rabbit Tropomodulin 2 Antibody (5E7G5) (NBP3-15905) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Tropomodulin 2 (Q9NZR1). MALPFQKELEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIP
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TMOD2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Tropomodulin 2 Antibody (5E7G5)

• MGC39481
• Neuronal tropomodulin
• N-TMOD
• NTMODtropomodulin-2
• tropomodulin 2 (neuronal)

Background

Tropomodulin 2 encodes a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. The encoded protein caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMOD2