Tropomodulin 3 Antibody (1E1) - Azide and BSA Free

Western Blot: Tropomodulin 3 Antibody (1E1) [H00029766-M10] - Analysis of TMOD3 expression in human kidney.

Immunocytochemistry/Immunofluorescence: Tropomodulin 3 Antibody (1E1) [H00029766-M10] - Analysis of monoclonal antibody to TMOD3 on HeLa cell. Antibody concentration 10 ug/ml

Western Blot: Tropomodulin 3 Antibody (1E1) [H00029766-M10] - Analysis of TMOD3 expression in transfected 293T cell line by TMOD3 monoclonal antibody (M10), clone 1E1. Lane 1: TMOD3 transfected lysate (Predicted MW: 39.6 KDa). Lane 2: Non-transfected lysate.

Sandwich ELISA: Tropomodulin 3 Antibody (1E1) [H00029766-M10] - Detection limit for recombinant GST tagged TMOD3 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 1E1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Tropomodulin 3 Antibody (1E1) - Azide and BSA Free Summary

• Immunogen: TMOD3 (NP_055362, 280 a.a. ~ 352 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RDNETLAELKIDNQRQQLGTAVELEMAKMLEENTNILKFGYQFTQQGPRTRAANAITKNNDLVRKRRVEGDHQ
• Specificity: TMOD3 - tropomodulin 3 (ubiquitous) (1E1)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TMOD3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Tropomodulin 3 Antibody (1E1) - Azide and BSA Free

• tropomodulin 3 (ubiquitous)
• tropomodulin-3
• Ubiquitous tropomodulin
• UTMOD
• U-Tmod

Background

Blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMOD3
• Entrez:
  • 29766(Human)
• Uniprot:
  • NP_055362(Human)