Recombinant Human TRMT61A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TRMT61A Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 289 of Human C14orf172 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGTDGPAGSDTSPFRSGTPMKEAVGHTGYLTFATKTPG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TRMT61A
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRMT61A Protein

  • C14orf172
  • chromosome 14 open reading frame 172
  • EC 2.1.1.36
  • FLJ40452
  • GCD14
  • Gcd14p
  • hTRM61
  • TRM61
  • tRNA (adenine-N(1)-)-methyltransferase catalytic subunit TRM61
  • tRNA (adenine-N(1)-)-methyltransferase catalytic subunit TRMT61A
  • tRNA methyltransferase 61 homolog A (S. cerevisiae)
  • tRNA(m1A58)-methyltransferase subunit TRM61
  • tRNA(m1A58)-methyltransferase subunit TRMT61A
  • tRNA(m1A58)MTase subunit TRM61
  • tRNA(m1A58)MTase subunit TRMT61A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27464
Species: Hu
Applications: WB, PEP-ELISA
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00022894-B01P
Species: Hu, Ch
Applications: WB, ELISA, ICC/IF
AF972
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85092
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-60949
Species: AB, Bv, Gt, Sh, WB
Applications: Flow, Func, IHC
H00000518-R01
Species: Hu
NBP1-82909
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-13729
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP

Publications for TRMT61A Recombinant Protein (H00115708-P01) (0)

There are no publications for TRMT61A Recombinant Protein (H00115708-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRMT61A Recombinant Protein (H00115708-P01) (0)

There are no reviews for TRMT61A Recombinant Protein (H00115708-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRMT61A Recombinant Protein (H00115708-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRMT61A Products

Bioinformatics Tool for TRMT61A Recombinant Protein (H00115708-P01)

Discover related pathways, diseases and genes to TRMT61A Recombinant Protein (H00115708-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TRMT61A

There are no specific blogs for TRMT61A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TRMT61A Antibody
NBP2-20728
MRP1 Antibody (IU2H10)
NB400-156-0.1ml

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TRMT61A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRMT61A