TRIM58 Recombinant Protein Antigen

Images

 
There are currently no images for TRIM58 Protein (NBP1-88608PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TRIM58 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRIM58.

Source: E.coli

Amino Acid Sequence: EAGEISFYNVTDGSYIYTFNQLFSGLLRPYFFICDATPLILPPTTIAGSGNWASRDHLDPASDVRDDHL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TRIM58
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-88608.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for TRIM58 Recombinant Protein Antigen

  • BIA2
  • DKFZp434C091
  • Protein BIA2
  • tripartite motif containing 58
  • tripartite motif-containing 58
  • tripartite motif-containing protein 58

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

25280002
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP2-38464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56450
Species: Hu
Applications: ICC/IF
NBP1-76899
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-36064
Species: Hu
Applications: WB, IHC-Fr
NBP2-06368
Species: Hu
NB300-549
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1214
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NBP1-87066
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56355
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-33876
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88608PEP
Species: Hu
Applications: AC

Publications for TRIM58 Protein (NBP1-88608PEP) (0)

There are no publications for TRIM58 Protein (NBP1-88608PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM58 Protein (NBP1-88608PEP) (0)

There are no reviews for TRIM58 Protein (NBP1-88608PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for TRIM58 Protein (NBP1-88608PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for TRIM58 Protein (NBP1-88608PEP)

Discover related pathways, diseases and genes to TRIM58 Protein (NBP1-88608PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM58 Protein (NBP1-88608PEP)

Discover more about diseases related to TRIM58 Protein (NBP1-88608PEP).
 

Pathways for TRIM58 Protein (NBP1-88608PEP)

View related products by pathway.

PTMs for TRIM58 Protein (NBP1-88608PEP)

Learn more about PTMs related to TRIM58 Protein (NBP1-88608PEP).
 

Research Areas for TRIM58 Protein (NBP1-88608PEP)

Find related products by research area.

Blogs on TRIM58

There are no specific blogs for TRIM58, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TRIM58 Antibody
NBP1-88608

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TRIM58 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM58