TRIM44 Antibody

Images

 
Western Blot: TRIM44 Antibody [H00054765-B01P] - Analysis of TRIM44 expression in transfected 293T cell line by TRIM44 polyclonal antibody. Lane 1: TRIM44 transfected lysate(37.84 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TRIM44 Antibody Summary

Immunogen
TRIM44 (NP_060053, 1 a.a. - 344 a.a.) full-length human protein. MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQKFLSHHLAEYVHGSQAWTPPADGEGAGKEEAEVKVEQEREIESEAGEESESEEESESEEESETEEESEDESDEESEEDSEEEMEDEQESEAEEDNQEEGESEAEGETEAESEFDPEIEMEAERVAKRKCPDHGLDLSTYCQEDRQLICVLCPVIGAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT
Specificity
TRIM44 - tripartite motif-containing 44,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
TRIM44
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TRIM44 Antibody

  • DIPBMGC3490
  • HSA249128
  • MC7
  • Protein DIPB
  • tripartite motif containing 44
  • tripartite motif-containing 44
  • tripartite motif-containing protein 44

Background

This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, namely a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43639
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-55135
Species: Hu
Applications: IHC, IHC-P, WB
NB100-1923
Species: Ce
Applications: IHC, IHC-P, IP, WB
202-IL
Species: Hu
Applications: BA
H00051127-M01
Species: Hu
Applications: ELISA, ICC/IF, PLA, S-ELISA, WB
AF4708
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NBP2-21601
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47791
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP1-89716
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-32767
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-32442
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85950
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-67632
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
H00006449-M06
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
NBP2-31775
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-68766
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-97665
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00004646-M02
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB

Publications for TRIM44 Antibody (H00054765-B01P) (0)

There are no publications for TRIM44 Antibody (H00054765-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM44 Antibody (H00054765-B01P) (0)

There are no reviews for TRIM44 Antibody (H00054765-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM44 Antibody (H00054765-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIM44 Products

Bioinformatics Tool for TRIM44 Antibody (H00054765-B01P)

Discover related pathways, diseases and genes to TRIM44 Antibody (H00054765-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM44 Antibody (H00054765-B01P)

Discover more about diseases related to TRIM44 Antibody (H00054765-B01P).
 

Pathways for TRIM44 Antibody (H00054765-B01P)

View related products by pathway.

PTMs for TRIM44 Antibody (H00054765-B01P)

Learn more about PTMs related to TRIM44 Antibody (H00054765-B01P).

Blogs on TRIM44

There are no specific blogs for TRIM44, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM44 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM44
Entrez
Uniprot