Home » TRIM44 » TRIM44 Antibodies » TRIM44 Antibody

TRIM44 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: TRIM44 Antibody [H00054765-B01P] - Analysis of TRIM44 expression in transfected 293T cell line by TRIM44 polyclonal antibody. Lane 1: TRIM44 transfected lysate(37.84 KDa). Lane 2: Non-transfected lysate.
Western Blot: TRIM44 Antibody [H00054765-B01P] - Analysis of TRIM44 expression in transfected 293T cell line by TRIM44 polyclonal antibody. Lane 1: TRIM44 transfected lysate(37.84 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TRIM44 Antibody Summary

Immunogen
TRIM44 (NP_060053, 1 a.a. - 344 a.a.) full-length human protein. MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQKFLSHHLAEYVHGSQAWTPPADGEGAGKEEAEVKVEQEREIESEAGEESESEEESESEEESETEEESEDESDEESEEDSEEEMEDEQESEAEEDNQEEGESEAEGETEAESEFDPEIEMEAERVAKRKCPDHGLDLSTYCQEDRQLICVLCPVIGAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT
Specificity
TRIM44 - tripartite motif-containing 44,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
TRIM44
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TRIM44 Antibody

  • DIPBMGC3490
  • HSA249128
  • MC7
  • Protein DIPB
  • tripartite motif containing 44
  • tripartite motif-containing 44
  • tripartite motif-containing protein 44

Background

This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, namely a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DCK Antibody
(10412)
NBP2-43639
Western Blot: DCK Antibody (10412) [NBP2-43639] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with DCK antibody diluted at 1:5000. HRP-conjugated anti-mouse IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: DCK Antibody (10412) [NBP2-43639] - DCK antibody (10412) detects DCK protein at nucleus by immunofluorescent analysis. Sample: HCT 116 cells were fixed in 4% paraformaldehyde at RT for 15 min. Red: DCK protein stained by DCK antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Western Blot: DCK Antibody (10412) [NBP2-43639] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with DCK antibody (10412) diluted at 1:500.
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
PAPSS2 Antibody
NBP1-55135
Western Blot: PAPSS2 Antibody [NBP1-55135] - 293T cells lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: PAPSS2 Antibody [NBP1-55135] - Human Lung Tissue Observed Staining: Cytoplasm of pneumocytes Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec.
Immunohistochemistry: PAPSS2 Antibody [NBP1-55135] - Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Tim
Species: Hu
Applications: IHC, IHC-P, WB
Sir2.1 Antibody
NB100-1923
Western Blot: Sir2.1 Antibody [NB100-1923] - Western blot using NB100-1923 against His tagged SIR-2.1 full-length protein.
(1 Review)
(2 Publications)
Species: Ce
Applications: IHC, IHC-P, IP, WB
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(26 Reviews)
(342 Publications)
Species: Hu
Applications: BA
TRIM17 Antibody
(2E11)
H00051127-M01
Sandwich ELISA: TRIM17 Antibody (2E11) [H00051127-M01] - Detection limit for recombinant GST tagged TRIM17 is 0.03 ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: TRIM17 Antibody (2E11) [H00051127-M01] - Analysis of monoclonal antibody to TRIM17 on HeLa cell . Antibody concentration 10 ug/ml.
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, PLA, S-ELISA, WB
TRIM Antibody
[Unconjugated]
AF4708
Western blot shows lysates of human peripheral blood mononuclear cells and Jurkat human acute T cell leukemia cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human TRIM Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4708) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for TRIM at approximately 27 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Human CD3+ T cells from peripheral blood mononuclear cells were stained with Goat Anti-Human TRIM Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4708, filled histo­gram) or isotype control antibody (Catalog #AB-108-C, open histo­gram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
ABCD4 Antibody
NBP2-21601
Immunocytochemistry/Immunofluorescence: ABCD4 Antibody [NBP2-21601] - A431 cells were fixed in ice-cold MeOH for 5 min. Green: ABCD4 protein stained by ABCD4 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Western Blot: ABCD4 Antibody [NBP2-21601] - Sample (30 ug of whole cell lysate) A: Raji 7. 5% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: ABCD4 Antibody [NBP2-21601] - Immunohistochemical analysis of paraffin-embedded AGS xenograft, using antibody at 1:500 dilution.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
HES-1 Antibody
(OTI4H1)
NBP1-47791
Western Blot: HES-1 Antibody (OTI4H1) [NBP1-47791] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY HES1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-HES1 (1:500).
Immunocytochemistry/Immunofluorescence: HES-1 Antibody (OTI4H1) [NBP1-47791] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Hes1.
Immunocytochemistry/Immunofluorescence: HES-1 Antibody (OTI4H1) [NBP1-47791] - HeLa cells using anti-HES1 mouse monoclonal antibody.
(7 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
HBLD1 Antibody
NBP1-89716
Western Blot: HBLD1 Antibody [NBP1-89716] - Analysis in control (vector only transfected HEK293T lysate) and ISCA2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: HBLD1 Antibody [NBP1-89716] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P, WB
HMGCL Antibody
NBP1-32767
Immunocytochemistry/Immunofluorescence: HMGCL Antibody [NBP1-32767] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: HMGCL protein stained by HMGCL antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Western Blot: HMGCL Antibody [NBP1-32767] - (30 ug of whole cell lysate) A: H1299 10% SDS PAGE; antibody diluted at 1:3000
Immunohistochemistry-Paraffin: HMGCL Antibody [NBP1-32767] - SW480 xenograft, using HMGCL antibody at 1:500 dilution. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
FJX1 Antibody
NBP2-32442
Immunohistochemistry-Paraffin: FJX1 Antibody [NBP2-32442] - Staining of human skeletal muscle shows no positivity in myocytes.
Immunohistochemistry-Paraffin: FJX1 Antibody [NBP2-32442] - Staining of human skin shows strong cytoplasmic positivity in keratinocytes.
Immunohistochemistry-Paraffin: FJX1 Antibody [NBP2-32442] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
USP1 Antibody
NBP1-85950
Western Blot: USP1 Antibody [NBP1-85950] - Analysis using Anti-USP1 antibody NBP1-85950 (A) shows similar pattern to independent antibody NBP2-55036 (B).
Immunohistochemistry-Paraffin: USP1 Antibody [NBP1-85950] - Analysis in human testis and pancreas tissues using NBP1-85950 antibody. Corresponding USP1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: USP1 Antibody [NBP1-85950] - Staining of human testis shows moderate nuclear positivity in cells in seminiferious ducts.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Cortactin Antibody
(SC61-08)
NBP2-67632
Flow Cytometry: Cortactin Antibody (SC61-08) [NBP2-67632] - Analysis of Hela cells with Cortactin antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: Cortactin Antibody (SC61-08) [NBP2-67632] - Staining Cortactin in A431 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Cortactin Antibody (SC61-08) [NBP2-67632] - Staining Cortactin in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
SGTA Antibody
(2E11)
H00006449-M06
Immunocytochemistry/Immunofluorescence: SGTA Antibody (2E11.) [H00006449-M06] - SGTA Antibody (2E11) [H00006449-M06] - Analysis of monoclonal antibody to SGTA on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: SGTA Antibody (2E11) [H00006449-M06] - SGTA expression in HeLa ( Cat # L013V1 ).
Western Blot: SGTA Antibody (2E11) [H00006449-M06] - SGTA expression in PC-12 ( Cat # L012V1 ).
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
JDP2 Antibody
NBP2-31775
Immunocytochemistry/Immunofluorescence: JDP2 Antibody [NBP2-31775] - Staining of human cell line MCF7 shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: JDP2 Antibody [NBP2-31775] - Staining of human kidney shows strong nuclear positivity in cells in tubules.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DYX1C1 Antibody
NBP1-68766
Immunohistochemistry-Paraffin: DYX1C1 Antibody [NBP1-68766] - Staining of paraffin embedded Human Cerebral Cortex. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: DYX1C1 Antibody [NBP1-68766] - Staining (0.1ug/ml) of COS1 cell lysates: untransfected (left lane) and transfected with full length recombinant Human DYX1C1 (right lane).
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
SP4 Antibody
NBP2-97665
Immunocytochemistry/Immunofluorescence: SP4 Antibody [NBP2-97665] - Immunofluorescence staining of SP4 in U251MG cells. Cells were fixed with 4% PFA, permeabilzed with 0.1% Triton X-100 in PBS, blocked with 10% serum, and incubated with rabbit anti-Human SP4 polyclonal antibody (dilution ratio 1:200) at 4C overnight. Then cells were stained with the Alexa Fluor(R)488-conjugated Goat Anti-rabbit IgG secondary antibody (green). Positive staining was localized to Nucleus.
Western Blot: SP4 Antibody [NBP2-97665] - Anti-SP4 rabbit polyclonal antibody at 1:500 dilution. Lane A: Hela Whole Cell Lysate Lane B: Jurkat Whole Cell Lysate Lysates/proteins at 30 ug per lane. Secondary Goat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 82 kDa. Observed band size: 97 kDa
Immunohistochemistry-Paraffin: SP4 Antibody [NBP2-97665] - Immunochemical staining of human SP4 in human lymph node with rabbit polyclonal antibody at 1:300 dilution, formalin-fixed paraffin embedded sections.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MYO6 Antibody
(2E12)
H00004646-M02
Western Blot: MYO6 Antibody (2E12) [H00004646-M02] - MYO6 monoclonal antibody (M02), clone 2E12. Analysis of MYO6 expression in MCF-7.
Sandwich ELISA: MYO6 Antibody (2E12) [H00004646-M02] - Detection limit for recombinant GST tagged MYO6 is 0.3 ng/ml as a capture antibody.
(1 Publication)
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB

Publications for TRIM44 Antibody (H00054765-B01P) (0)

There are no publications for TRIM44 Antibody (H00054765-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM44 Antibody (H00054765-B01P) (0)

There are no reviews for TRIM44 Antibody (H00054765-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM44 Antibody (H00054765-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIM44 Products

Bioinformatics Tool for TRIM44 Antibody (H00054765-B01P)

Discover related pathways, diseases and genes to TRIM44 Antibody (H00054765-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM44 Antibody (H00054765-B01P)

Discover more about diseases related to TRIM44 Antibody (H00054765-B01P).
 

Pathways for TRIM44 Antibody (H00054765-B01P)

View related products by pathway.

PTMs for TRIM44 Antibody (H00054765-B01P)

Learn more about PTMs related to TRIM44 Antibody (H00054765-B01P).

Blogs on TRIM44

There are no specific blogs for TRIM44, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM44 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TRIM44
Entrez
Uniprot