TRIM35 Antibody - BSA Free

Western Blot: TRIM35 Antibody [NBP2-88474] - WB Suggested Anti-TRIM35 Antibody Titration: 2.5ug/ml. Positive Control: HepG2 cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

TRIM35 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TRIM35 Antibody - BSA Free (NBP2-88474) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human TRIM35. Peptide sequence: RTQGVEGDHCVTSDPATSPLVLAIPRRLRVELECEEGELSFYDAERHCHL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRIM35
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for TRIM35 Antibody - BSA Free

• HLS5Hemopoietic lineage switch protein 5
• KIAA1098MGC17233
• MAIR
• tripartite motif containing 35
• tripartite motif-containing 35
• tripartite motif-containing protein 35

Background

TRIM35 is encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRIM35