TRIM31 Antibody

Images

 
Immunohistochemistry-Paraffin: TRIM31 Antibody [NBP2-13483] Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIM31 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DSLKTKQNMPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKSR HDSITGSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM31
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TRIM31 Protein (NBP2-13483PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRIM31 Antibody

  • C6orf13E3 ubiquitin-protein ligase TRIM31
  • EC 6.3.2.-
  • HCG1
  • HCGItripartite motif-containing 31 gamma
  • RNFring finger protein
  • tripartite motif containing 31
  • tripartite motif-containing 31
  • Tripartite motif-containing protein 31

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-13885
Species: Hu
NBP1-51689
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
H00009025-B01P
Species: Hu
Applications: WB, ICC/IF
AF1555
Species: Hu
Applications: WB
NBP2-49156
Species: Hu
Applications: ICC/IF, IHC
AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NB100-56357
Species: Hu
Applications: WB, IP
NB100-56360
Species: Hu
Applications: WB
NB100-760
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-2244
Species: Hu
Applications: WB, ICC/IF, IHC-P, IP
AF7217
Species: Hu, Mu
Applications: WB, ICC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89533
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
AF8408
Species: Hu
Applications: WB
H00011026-M01
Species: Hu
Applications: WB, ELISA
AF482
Species: Mu
Applications: WB, IHC
NBP2-38132
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-13483
Species: Hu
Applications: IHC, IHC-P

Publications for TRIM31 Antibody (NBP2-13483) (0)

There are no publications for TRIM31 Antibody (NBP2-13483).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM31 Antibody (NBP2-13483) (0)

There are no reviews for TRIM31 Antibody (NBP2-13483). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TRIM31 Antibody (NBP2-13483) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIM31 Products

Bioinformatics Tool for TRIM31 Antibody (NBP2-13483)

Discover related pathways, diseases and genes to TRIM31 Antibody (NBP2-13483). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM31 Antibody (NBP2-13483)

Discover more about diseases related to TRIM31 Antibody (NBP2-13483).
 

Pathways for TRIM31 Antibody (NBP2-13483)

View related products by pathway.

Research Areas for TRIM31 Antibody (NBP2-13483)

Find related products by research area.

Blogs on TRIM31

There are no specific blogs for TRIM31, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM31 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM31