TR4/NR2C2 Recombinant Protein Antigen

Images

 
There are currently no images for TR4/NR2C2 Protein (NBP1-81658PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TR4/NR2C2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NR2C2.

Source: E. coli

Amino Acid Sequence: DGARQTGLLDPGMLVNIQQPLIREDGTVLLATDSKAETSQGALGTLANVVTSLANLSESLNNGDTSEIQPEDQSASEITRAFDTLAKALNTTDSSSSPSLADGIDTSGGGSIHVISRDQSTPIIEVEGPLLSDTHVTFKLTMPSPMP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NR2C2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81658.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TR4/NR2C2 Recombinant Protein Antigen

  • hTAK1
  • NR2C2
  • Nuclear hormone receptor TR4
  • nuclear receptor subfamily 2 group C member 2
  • nuclear receptor subfamily 2, group C, member 2
  • Orphan nuclear receptor TAK1
  • Orphan nuclear receptor TR4
  • TAK1
  • TAK1TR4TR2R1
  • Testicular receptor 4
  • TR4 nuclear hormone receptor
  • TR4

Background

TR4 (TAK1, NR2C2) is an orphan nuclear receptor. TR4 was originally cloned from lymphoblastoma Raji cells or mouse brain cDNA library. No ligand has been reported. Northern blot shows TR4 is transcribed as a 9kb mRNA in many tissues and as a 2.8kb mRNA in testis, mainly in spermatocytes. TR4 has two isoforms called TR4alpha1 and TR4 alpha2,which differ in 19 amino acids coded by two separate exons. Both products translated from the 9kb transcript are ubiquitously expressed. Since TR4 binds to the same elements for the RAR-RXR or TR-RXR heterodimers, TR4 may have an inhibitory effect for retinoic-acid mediated transactivation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-26506
Species: Hu, Mu, Rt
Applications: B/N, In vitro
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF3578
Species: Hu, Mu
Applications: ICC, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NB100-56363
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP3-25708
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
H00010598-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-81575
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47839
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-55133
Species: Hu
Applications: ICC/IF, WB
201-LB
Species: Hu
Applications: BA
NBP1-81658PEP
Species: Hu
Applications: AC

Publications for TR4/NR2C2 Protein (NBP1-81658PEP) (0)

There are no publications for TR4/NR2C2 Protein (NBP1-81658PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TR4/NR2C2 Protein (NBP1-81658PEP) (0)

There are no reviews for TR4/NR2C2 Protein (NBP1-81658PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TR4/NR2C2 Protein (NBP1-81658PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TR4/NR2C2 Products

Research Areas for TR4/NR2C2 Protein (NBP1-81658PEP)

Find related products by research area.

Blogs on TR4/NR2C2

There are no specific blogs for TR4/NR2C2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TR4/NR2C2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NR2C2