Recombinant Human TR alpha/NR1A1/Thyroid Hormone Receptor alpha Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TR alpha/NR1A1/Thyroid Hormone Receptor alpha Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 87-178 of Human THRA partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRST

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
THRA
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00007067-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TR alpha/NR1A1/Thyroid Hormone Receptor alpha Protein

  • AR7
  • c-ERBA-1
  • c-erbA-alpha
  • EAR7
  • EAR-7
  • EAR-7.1/EAR-7.2
  • ERBA
  • ERBA1thyroid hormone receptor, alpha (avian erythroblastic leukemia viral (v-erb-a)oncogene homolog)
  • ERBA-related 7
  • MGC000261
  • MGC43240
  • NR1A 1
  • NR1A1
  • NR1A1THRA3
  • Nuclear receptor subfamily 1 group A member 1
  • THRA
  • THRA1ERB-T-1
  • THRA2
  • thyroid hormone receptor alpha
  • thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a)oncogene homolog, avian)
  • TR alpha
  • triiodothyronine receptor
  • v-ErbA1
  • V-erbA-related protein 7

Background

THRA - thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homolog, avian)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

1670-SE
Species: Ec
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
H00009572-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP

Publications for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Partial Recombinant Protein (H00007067-Q01)(1)

Reviews for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Partial Recombinant Protein (H00007067-Q01) (0)

There are no reviews for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Partial Recombinant Protein (H00007067-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Partial Recombinant Protein (H00007067-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TR alpha/NR1A1/Thyroid Hormone Receptor alpha Products

Bioinformatics Tool for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Partial Recombinant Protein (H00007067-Q01)

Discover related pathways, diseases and genes to TR alpha/NR1A1/Thyroid Hormone Receptor alpha Partial Recombinant Protein (H00007067-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Partial Recombinant Protein (H00007067-Q01)

Discover more about diseases related to TR alpha/NR1A1/Thyroid Hormone Receptor alpha Partial Recombinant Protein (H00007067-Q01).
 

Pathways for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Partial Recombinant Protein (H00007067-Q01)

View related products by pathway.

PTMs for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Partial Recombinant Protein (H00007067-Q01)

Learn more about PTMs related to TR alpha/NR1A1/Thyroid Hormone Receptor alpha Partial Recombinant Protein (H00007067-Q01).

Blogs on TR alpha/NR1A1/Thyroid Hormone Receptor alpha

There are no specific blogs for TR alpha/NR1A1/Thyroid Hormone Receptor alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TR alpha/NR1A1/Thyroid Hormone Receptor alpha Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol THRA
Entrez