![Western Blot: TP73-AS1 Antibody [NBP1-98566] - Jurkat Cell Lysate 1.0ug/ml, Gel Concentration: 12%](http://images.novusbio.com/fullsize/TP73-AS1-Antibody-Western-Blot-NBP1-98566-img0002.jpg "Western Blot: TP73-AS1 Antibody [NBP1-98566] - Jurkat Cell Lysate 1.0ug/ml, Gel Concentration: 12%")
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | The immunogen for this antibody is TP73-AS1 - C-terminal region. Peptide sequence VVDENSCCLLYVVEDQLCDVEQAFRAEHLGQHQSGSGTGCRHCPQRPAAL. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TP73-AS1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
![Persephin Antibody (275508) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Persephin Antibody (275508) [Unconjugated]")
![Western Blot Syntaxin-BP3/Munc18c Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin-BP3_AF5659_Western_Blot_12110.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TP73-AS1 |
![Immunoprecipitation bcl-x Antibody [Unconjugated]](https://images.novusbio.com/images2/Bcl-x_AF800_Immunoprecipitation_1612.jpg)
![Western Blot bcl-x Antibody [Unconjugated]](https://images.novusbio.com/images2/Bcl-x_AF800_Western_Blot_5903.jpg)
![Simple Western bcl-x Antibody [Unconjugated]](https://images.novusbio.com/images2/Bclx_AF800_Simple_Western_16514.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/PlGF_DPG00_ELISA_158.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/DATA_PlGF_DPG00_ELISA_788.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/DATA_PlGF_DPG00_ELISA_789.jpg)
![Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]](https://images.novusbio.com/images2/Reg1A_MAB4937_Flow_Cytometry_8512.jpg)
