Recombinant Human TOR/mTOR Protein

Images

 
Recombinant Human TOR/mTOR Protein [H00002475-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human TOR/mTOR Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1521-1620 of Human TOR/mTOR

Source: Wheat Germ

Amino Acid Sequence: WGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MTOR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00002475-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TOR/mTOR Protein

  • EC 2.7.11.1
  • FK506 binding protein 12-rapamycin associated protein 1
  • FK506 binding protein 12-rapamycin associated protein 2
  • FK506-binding protein 12-rapamycin complex-associated protein 1
  • FKBP12-rapamycin complex-associated protein
  • FLJ44809
  • FRAP
  • FRAP1
  • FRAP1FKBP12-rapamycin complex-associated protein 1
  • FRAP2
  • Mammalian target of rapamycin
  • mechanistic target of rapamycin (serine/threonine kinase)
  • Mechanistic target of rapamycin
  • MTOR
  • RAFT1
  • rapamycin and FKBP12 target 1
  • rapamycin associated protein FRAP2
  • Rapamycin target protein 1
  • RAPT1FKBP-rapamycin associated protein
  • serine/threonine-protein kinase mTOR
  • TOR

Background

FRAP1 - FK506 binding protein 12-rapamycin associated protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-19804
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38535
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
MAB40401
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB4379
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
H00002475-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for TOR/mTOR Partial Recombinant Protein (H00002475-Q01)(1)

Reviews for TOR/mTOR Partial Recombinant Protein (H00002475-Q01) (0)

There are no reviews for TOR/mTOR Partial Recombinant Protein (H00002475-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TOR/mTOR Partial Recombinant Protein (H00002475-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for TOR/mTOR Partial Recombinant Protein (H00002475-Q01)

Discover related pathways, diseases and genes to TOR/mTOR Partial Recombinant Protein (H00002475-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOR/mTOR Partial Recombinant Protein (H00002475-Q01)

Discover more about diseases related to TOR/mTOR Partial Recombinant Protein (H00002475-Q01).
 

Pathways for TOR/mTOR Partial Recombinant Protein (H00002475-Q01)

View related products by pathway.

PTMs for TOR/mTOR Partial Recombinant Protein (H00002475-Q01)

Learn more about PTMs related to TOR/mTOR Partial Recombinant Protein (H00002475-Q01).
 

Research Areas for TOR/mTOR Partial Recombinant Protein (H00002475-Q01)

Find related products by research area.

Blogs on TOR/mTOR.

The Many Connections Between Autophagy and Kidney Disease
By Yoskaly Lazo-Fernandez, PhD The first description of what is called today an autophagosome was given in a paper published in 1957. Its author employed electron microscopy to observe the neonatal features of mous...  Read full blog post.

Thomson Reuters Predicts 2016 Nobel Prize Winners
Here at Bio-Techne we always look forward to the annual announcements of winners of the highly coveted Nobel Prize – the greatest award in science. How can you go about predicting which scientists might be in line for a life-changing phone-call fro...  Read full blog post.

mTOR - a central regulator of cell metabolism
The mammalian target of rapamycin (mTOR) signaling pathway allows cells to monitor environmental signals like nutrient availability and oxygen levels. mTOR is a phosphoinositide 3-kinase (PI3K)-related protein that assembles into large protein comp...  Read full blog post.

Customers Who Bought This Also Bought

4EBP1 Antibody
NB200-157

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TOR/mTOR Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MTOR
Entrez