Recombinant Human TOR/mTOR GST (N-Term) Protein

Images

 
Recombinant Human TOR/mTOR Protein [H00002475-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human TOR/mTOR GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1521-1620 of Human TOR/mTOR

Source: Wheat Germ (in vitro)

Amino Acid Sequence: WGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
MTOR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00002475-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TOR/mTOR GST (N-Term) Protein

  • EC 2.7.11.1
  • FK506 binding protein 12-rapamycin associated protein 1
  • FK506 binding protein 12-rapamycin associated protein 2
  • FK506-binding protein 12-rapamycin complex-associated protein 1
  • FKBP12-rapamycin complex-associated protein
  • FLJ44809
  • FRAP
  • FRAP1
  • FRAP1FKBP12-rapamycin complex-associated protein 1
  • FRAP2
  • Mammalian target of rapamycin
  • mechanistic target of rapamycin (serine/threonine kinase)
  • Mechanistic target of rapamycin
  • MTOR
  • RAFT1
  • rapamycin and FKBP12 target 1
  • rapamycin associated protein FRAP2
  • Rapamycin target protein 1
  • RAPT1FKBP-rapamycin associated protein
  • serine/threonine-protein kinase mTOR
  • TOR

Background

FRAP1 - FK506 binding protein 12-rapamycin associated protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF3918
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NB200-157
Species: Hu
Applications: IHC,  IHC-P, KO, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF8962
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF847
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
DVE00
Species: Hu
Applications: ELISA
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-67552
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-91228
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
NBP2-46234
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC,  IHC-P, WB
H00002475-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for TOR/mTOR Partial Recombinant Protein (H00002475-Q01)(1)

Reviews for TOR/mTOR Partial Recombinant Protein (H00002475-Q01) (0)

There are no reviews for TOR/mTOR Partial Recombinant Protein (H00002475-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/Â¥70 Yuan/Â¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/Â¥150 Yuan/Â¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TOR/mTOR Partial Recombinant Protein (H00002475-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TOR/mTOR Products

Research Areas for TOR/mTOR Partial Recombinant Protein (H00002475-Q01)

Find related products by research area.

Blogs on TOR/mTOR.

Staufen1 Overabundance and the Consequent mTOR Hyperactivity in Amyotrophic Lateral Sclerosis, Spinocerebellar Ataxia Type 2, Alzheimer’s, Parkinson’s, and Huntington’s Diseases
Jamshed Arslan, Pharm D, PhD Neurodegenerative disorders involve loss of function and, ultimately, death of neurons. Selective neuronal vulnerability has been observed in a variety of neurodegenerative diseases. Fo...  Read full blog post.

mTOR Signaling and the Tumor Microenvironment
By Yoskaly Lazo-Fernandez, PhD The mammalian target of rapamycin (mTOR) is a conserved serine/threonine kinase that, as a member of two distinct intracellular protein complexes, mTORC1 and mTORC2, regulates protein ...  Read full blog post.

The Many Connections Between Autophagy and Kidney Disease
By Yoskaly Lazo-Fernandez, PhD The first description of what is called today an autophagosome was given in a paper published in 1957. Its author employed electron microscopy to observe the neonatal features of mous...  Read full blog post.

Thomson Reuters Predicts 2016 Nobel Prize Winners
Here at Bio-Techne we always look forward to the annual announcements of winners of the highly coveted Nobel Prize – the greatest award in science. How can you go about predicting which scientists might be in line for a life-changing phone-call fro...  Read full blog post.

mTOR - a central regulator of cell metabolism
The mammalian target of rapamycin (mTOR) signaling pathway allows cells to monitor environmental signals like nutrient availability and oxygen levels. mTOR is a phosphoinositide 3-kinase (PI3K)-related protein that assembles into large protein comp...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TOR/mTOR GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MTOR