Tomosyn Recombinant Protein Antigen

Images

 
There are currently no images for Tomosyn Recombinant Protein Antigen (NBP2-56176PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Tomosyn Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Tomosyn.

Source: E. coli

Amino Acid Sequence: SAHVIIYRFSKQEVITEVIPMLEVRLLYEINDVETPEGEQPPPLPTPVGGSNPQPIPPQSHPSTSSSSSDGLRDN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STXBP5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56176.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Tomosyn Recombinant Protein Antigen

  • FLJ30922
  • Lethal(2) giant larvae protein homolog 3
  • LGL3
  • LLGL3Nbla04300
  • MGC141942
  • MGC141968
  • putative protein product of Nbla04300
  • syntaxin binding protein 5 (tomosyn)
  • syntaxin-binding protein 5
  • tomosyn
  • tomosyn-1

Background

Inhibits translocation of GLUT4 from intracellular vesicles to the plasma membrane. Plays a regulatory role in calcium-dependent exocytosis and neurotransmitter release. Inhibits membrane fusion between transport vesicles and the plasma membrane. May modulate the assembly of trans-SNARE complexes between transport vesicles and the plasma membrane. Competes with STXBP1 for STX1 binding.; SUBUNIT: Part of a complex that contains STXBP5, STX4A and SNAP23. Interacts with STX1A and STX4A via its v-SNARE homology domain. Part of a complex that contains STX1, STXBP5, SNAP25 and SYT1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33714
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB100-91288
Species: Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-15706
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-87035
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF2568
Species: Mu
Applications: IHC, WB
NBP3-13179
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB600-586
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P
H00003993-M06
Species: Ca, Dr, Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF5675
Species: Hu, Mu, Rt
Applications: IHC, IP, KO, WB
NBP1-87439
Species: Hu
Applications: IHC,  IHC-P, WB
MAB4364
Species: Rt
Applications: ICC, IHC, IP, KO, WB
NBP1-31508
Species: Hu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-1227
Species: Hu, Mu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-82964
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP
NBP2-15110
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
AF4990
Species: Hu, Mu
Applications: IHC, WB

Publications for Tomosyn Recombinant Protein Antigen (NBP2-56176PEP) (0)

There are no publications for Tomosyn Recombinant Protein Antigen (NBP2-56176PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tomosyn Recombinant Protein Antigen (NBP2-56176PEP) (0)

There are no reviews for Tomosyn Recombinant Protein Antigen (NBP2-56176PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Tomosyn Recombinant Protein Antigen (NBP2-56176PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Tomosyn Products

Research Areas for Tomosyn Recombinant Protein Antigen (NBP2-56176PEP)

Find related products by research area.

Blogs on Tomosyn

There are no specific blogs for Tomosyn, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Tomosyn Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol STXBP5