TOMM6 Antibody - BSA Free

Western Blot: TOMM6 Antibody [NBP2-93442] - Analysis of extracts of various cell lines, using TOMM6 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 90s.

Immunohistochemistry: TOMM6 Antibody - BSA Free [NBP2-93442] - Immunohistochemistry analysis of TOMM6 in paraffin-embedded human lung cancer tissue using TOMM6 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: TOMM6 Antibody - BSA Free [NBP2-93442] - Immunohistochemistry analysis of TOMM6 in paraffin-embedded human thyroid cancer tissue using TOMM6 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: TOMM6 Antibody - BSA Free [NBP2-93442] - Immunohistochemistry analysis of TOMM6 in paraffin-embedded human liver cancer tissue using TOMM6 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Product Discontinued

TOMM6 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-74 of human TOMM6 (NP_001127965.1). MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQPGV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TOMM6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 8 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TOMM6 Antibody - BSA Free

• FLJ32622
• mitochondrial import receptor subunit TOM6 homolog
• over-expressed breast tumor protein
• TOM6
• translocase of outer membrane 6 kDa subunit homolog
• translocase of outer mitochondrial membrane 6 homolog (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TOMM6