TOMM5 Antibody


Immunocytochemistry/ Immunofluorescence: TOMM5 Antibody [NBP2-14654] - Immunofluorescent staining of human cell line HeLa shows localization to mitochondria.
Immunohistochemistry-Paraffin: TOMM5 Antibody [NBP2-14654] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

TOMM5 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLD
Specificity of human TOMM5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
TOMM5 Protein (NBP2-14654PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TOMM5 Antibody

  • bA613M10.3
  • C9orf105
  • RP11-263I4.1
  • Tom5
  • TOMM5 translocase of outer mitochondrial membrane 5 homolog (yeast)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Av, Bv, Fi, Gt, Ma, Re
Applications: WB, ELISA, IHC
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TOMM5 Antibody (NBP2-14654) (0)

There are no publications for TOMM5 Antibody (NBP2-14654).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOMM5 Antibody (NBP2-14654) (0)

There are no reviews for TOMM5 Antibody (NBP2-14654). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TOMM5 Antibody (NBP2-14654) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TOMM5 Products

TOMM5 NBP2-14654

Bioinformatics Tool for TOMM5 Antibody (NBP2-14654)

Discover related pathways, diseases and genes to TOMM5 Antibody (NBP2-14654). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOMM5 Antibody (NBP2-14654)

Discover more about diseases related to TOMM5 Antibody (NBP2-14654).

Pathways for TOMM5 Antibody (NBP2-14654)

View related products by pathway.

PTMs for TOMM5 Antibody (NBP2-14654)

Learn more about PTMs related to TOMM5 Antibody (NBP2-14654).

Blogs on TOMM5

There are no specific blogs for TOMM5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TOMM5 Antibody and receive a gift card or discount.


Gene Symbol TOMM5