TOMM5 Antibody

Immunocytochemistry/Immunofluorescence: TOMM5 Antibody [NBP2-14654] - Immunofluorescent staining of human cell line HeLa shows localization to mitochondria.

Immunohistochemistry-Paraffin: TOMM5 Antibody [NBP2-14654] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Discontinued

TOMM5 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLD
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TOMM5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TOMM5 Antibody

• bA613M10.3
• C9orf105
• RP11-263I4.1
• Tom5
• TOMM5 translocase of outer mitochondrial membrane 5 homolog (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TOMM5