TOMM34 Recombinant Protein Antigen

Images

 
There are currently no images for TOMM34 Protein (NBP1-81655PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TOMM34 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TOMM34.

Source: E.coli

Amino Acid Sequence: LCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TOMM34
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-81655.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for TOMM34 Recombinant Protein Antigen

  • hTom34
  • HTOM34P
  • mitochondrial import receptor subunit TOM34
  • outer mitochondrial membrane translocase (34kD)
  • TOM34
  • Translocase of outer membrane 34 kDa subunit
  • translocase of outer mitochondrial membrane 34
  • URCC3

Background

TOMM34 is encoded by this gene is involved in the import of precursor proteins into mitochondria. The encoded protein has a chaperone-like activity, binding the mature portion of unfolded proteins and aiding their import into mitochondria. This protein, which is found in the cytoplasm and sometimes associated with the outer mitochondrial membrane, has a weak ATPase activity and contains 6 TPR repeats.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81556
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, Simple Western, WB
NBP1-89125
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-87408
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-85018
Species: Hu
Applications: IHC, IHC-P
AF644
Species: Mu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
NBP2-93792
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-85025
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88875
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77685
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-86941
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF4820
Species: Hu
Applications: IHC, WB
NBP1-71648
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, KO, Simple Western, WB
H00010431-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB100-2866
Species: Hu
Applications: ICC/IF, IP, KD, WB
NBP2-67817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-2559
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB

Publications for TOMM34 Protein (NBP1-81655PEP) (0)

There are no publications for TOMM34 Protein (NBP1-81655PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOMM34 Protein (NBP1-81655PEP) (0)

There are no reviews for TOMM34 Protein (NBP1-81655PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TOMM34 Protein (NBP1-81655PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TOMM34 Products

Bioinformatics Tool for TOMM34 Protein (NBP1-81655PEP)

Discover related pathways, diseases and genes to TOMM34 Protein (NBP1-81655PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOMM34 Protein (NBP1-81655PEP)

Discover more about diseases related to TOMM34 Protein (NBP1-81655PEP).
 

Pathways for TOMM34 Protein (NBP1-81655PEP)

View related products by pathway.

PTMs for TOMM34 Protein (NBP1-81655PEP)

Learn more about PTMs related to TOMM34 Protein (NBP1-81655PEP).
 

Research Areas for TOMM34 Protein (NBP1-81655PEP)

Find related products by research area.

Blogs on TOMM34

There are no specific blogs for TOMM34, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TOMM34 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TOMM34