Recombinant Human TNFAIP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TNFAIP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 258-316 of Human TNFAIP1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TPRVPDNSLLEATSRSRSQASPSEDEETFELRDRVRRIHVKRYSTYDDRQLGHQSTHRD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TNFAIP1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TNFAIP1 Protein

  • B12
  • B61
  • BACURD2
  • BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2
  • BTB/POZ domain-containing protein TNFAIP1
  • EDP1
  • hBACURD2
  • MGC2317
  • Protein B12
  • tumor necrosis factor, alpha-induced protein 1 (endothelial)
  • Tumor necrosis factor, alpha-induced protein 1, endothelial

Background

TNFAIP1 - tumor necrosis factor, alpha-induced protein 1 (endothelial)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-233
Species: Hu
Applications: WB, PLA
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-83552
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00003703-M02
Species: Hu
Applications: WB, ELISA, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for TNFAIP1 Partial Recombinant Protein (H00007126-Q01) (0)

There are no publications for TNFAIP1 Partial Recombinant Protein (H00007126-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TNFAIP1 Partial Recombinant Protein (H00007126-Q01) (0)

There are no reviews for TNFAIP1 Partial Recombinant Protein (H00007126-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TNFAIP1 Partial Recombinant Protein (H00007126-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TNFAIP1 Products

Bioinformatics Tool for TNFAIP1 Partial Recombinant Protein (H00007126-Q01)

Discover related pathways, diseases and genes to TNFAIP1 Partial Recombinant Protein (H00007126-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TNFAIP1 Partial Recombinant Protein (H00007126-Q01)

Discover more about diseases related to TNFAIP1 Partial Recombinant Protein (H00007126-Q01).
 

Pathways for TNFAIP1 Partial Recombinant Protein (H00007126-Q01)

View related products by pathway.

PTMs for TNFAIP1 Partial Recombinant Protein (H00007126-Q01)

Learn more about PTMs related to TNFAIP1 Partial Recombinant Protein (H00007126-Q01).
 

Research Areas for TNFAIP1 Partial Recombinant Protein (H00007126-Q01)

Find related products by research area.

Blogs on TNFAIP1

There are no specific blogs for TNFAIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532
TNFAIP1 Antibody
NBP1-88930

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TNFAIP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFAIP1