TMPRSS11E Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit TMPRSS11E Antibody - BSA Free (NBP2-85955) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TMPRSS11E. Peptide sequence: CIGLTVHYVRYNQKKTYNYYSTLSFTTDKLYAEFGREASNNFTEMSQRLE The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TMPRSS11E |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for TMPRSS11E Antibody - BSA Free
Background
TMPRSS11E is a member of a larger family of membrane attached serine proteases, a poorly defined group that includes TMPRSS11A, B, C, D, E, F, Hepsin, Corin, Matriptase 1, 2 and 3. The highest degree of identity is with TMPRSS11A, which shares 43% identity at the amino acid level. TMPRSS11E has a domain structure of an aminoterminal cytoplasmic domain, followed by a transmembrane domain, a SEA domain (Sea urchin sperm protein, Enterokinase, Agrin), a short spacer, then the trypsin like serine protease domain. The SEA domain is thought to play a role in carbohydrate binding in the analogous protein sequences where it is found, but the role in TMPRSS11E is unclear. The cleavage of the Arg191 Ile192 bond liberates the catalytic domain. TMPRSS11E has been shown to cleave fibronectin, gelatin, casein and pro uPA in vitro, and to form complexes with serpinA5 and serpinE1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: EnzAct
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: EnzAct
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, Simple Western, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: WB
Publications for TMPRSS11E Antibody (NBP2-85955) (0)
There are no publications for TMPRSS11E Antibody (NBP2-85955).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TMPRSS11E Antibody (NBP2-85955) (0)
There are no reviews for TMPRSS11E Antibody (NBP2-85955).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TMPRSS11E Antibody (NBP2-85955) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TMPRSS11E Products
Blogs on TMPRSS11E