Recombinant Human TMEM9B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TMEM9B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-124 of Human C11orf15 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPVRGPDVEAYCLRCECKYEERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRLFGHAQLIQSDDDIGDHQPFANAHDVLARSRSRANVLNKVEYAQQRWKLQVQEQRKSVFDRHVVLS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TMEM9B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TMEM9B Protein

  • C11orf15
  • chromosome 11 open reading frame 15
  • TMEM9 domain family, member B
  • transmembrane protein 9B

Background

C11orf15( AAH15884, 1 a.a. - 125 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69589
Species: Hu
Applications: WB
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-02293
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32367
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-46228
Species: Hu
Applications: WB, IHC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB100-56363
Species: Hu, Mu
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14336
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP1-90310
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57788
Species: Hu
Applications: ICC/IF
AF3850
Species: Hu
Applications: WB
NBP1-83541
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00056674-P02
Species: Hu
Applications: WB, ELISA, PA

Publications for TMEM9B Recombinant Protein (H00056674-P02) (0)

There are no publications for TMEM9B Recombinant Protein (H00056674-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM9B Recombinant Protein (H00056674-P02) (0)

There are no reviews for TMEM9B Recombinant Protein (H00056674-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM9B Recombinant Protein (H00056674-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TMEM9B Products

Bioinformatics Tool for TMEM9B Recombinant Protein (H00056674-P02)

Discover related pathways, diseases and genes to TMEM9B Recombinant Protein (H00056674-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM9B Recombinant Protein (H00056674-P02)

Discover more about diseases related to TMEM9B Recombinant Protein (H00056674-P02).
 

Pathways for TMEM9B Recombinant Protein (H00056674-P02)

View related products by pathway.

PTMs for TMEM9B Recombinant Protein (H00056674-P02)

Learn more about PTMs related to TMEM9B Recombinant Protein (H00056674-P02).
 

Research Areas for TMEM9B Recombinant Protein (H00056674-P02)

Find related products by research area.

Blogs on TMEM9B

There are no specific blogs for TMEM9B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TMEM9B Antibody
NBP1-88545

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TMEM9B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM9B