TMEM47 Antibody

Product Discontinued

TMEM47 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DHQYYLSLWESCRKPASLDIWHCESTLSSDWQIAT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMEM47
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1- 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TMEM47 Antibody

• BCMP1DKFZP761J17121
• Brain cell membrane protein 1
• DKFZp564E153
• FLJ18096
• MGC32949
• TM4SF10
• Transmembrane 4 superfamily member 10DKFZp761J17121
• transmembrane protein 47

Background

TMEM47 encodes a member of the PMP22/EMP/claudin protein family. The encoded protein is localized to the ER and the plasma membrane. In dogs, transcripts of this gene exist at high levels in the brain. [provided by RefSeq]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Reviews for TMEM47 Antibody (NBP2-32046) (3)

Average Rating: 3

(Based on 3 reviews)

We have 3 reviews tested in 2 species: Other, Pig.

reviewed by: Verified Customer ICC Pig 06/07/2017

Summary

• Application: Immunocytochemistry
• Sample Tested: Pig TM cells
• Species: Pig
• Lot: N/A

reviewed by: Verified Customer ICC Pig 06/07/2017

Summary

• Application: Immunocytochemistry
• Sample Tested: pig SC cells
• Species: Pig
• Lot: N/A

reviewed by: Verified Customer WB Other 09/19/2014

Summary

• Application: Western Blot
• Sample Tested: 50mg cortex, 50 mg cerebellum loaded 30 ug total protein
• Species: Other

Bioinformatics

• Gene Symbol: TMEM47
• Uniprot:
  • Q9BQJ4(Human)