TMEM47 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TMEM47 Antibody [NBP2-32046] - Immunofluorescent staining of human cell line RT4 shows localization to nuclear membrane.
Immunohistochemistry-Paraffin: TMEM47 Antibody [NBP2-32046] - Staining of human oral mucosa shows strong nuclear membranous positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM47 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DHQYYLSLWESCRKPASLDIWHCESTLSSDWQIAT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM47
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TMEM47 Protein (NBP2-32046PEP)
Reviewed Applications
Read 1 Review rated 3
using
NBP2-32046 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM47 Antibody

  • BCMP1DKFZP761J17121
  • Brain cell membrane protein 1
  • DKFZp564E153
  • FLJ18096
  • MGC32949
  • TM4SF10
  • Transmembrane 4 superfamily member 10DKFZp761J17121
  • transmembrane protein 47

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBL1-15012
Species: Hu
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
H00007348-M05
Species: Hu
Applications: WB, ELISA
NBP1-59438
Species: Hu
Applications: WB, ELISA, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB3857
Species: Hu
Applications: WB
AF7288
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-76822
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90042
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90042
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-182
Species: Hu
Applications: WB, IHC-P, IP, PLA

Publications for TMEM47 Antibody (NBP2-32046) (0)

There are no publications for TMEM47 Antibody (NBP2-32046).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for TMEM47 Antibody (NBP2-32046) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Other.
We have 1 review tested in 1 application: WB.

Reviews using NBP2-32046:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Other
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot TMEM47 NBP2-32046
Enlarge
reviewed by:
Anonymous
WB Other 09/19/2014
View

Summary

ApplicationWestern Blot
Sample Tested50mg cortex, 50 mg cerebellum loaded 30 ug total protein
SpeciesOther
Comments50mg cortex, 50 mg cerebellum loaded 30 ug total protein

Comments

Comments50mg cortex, 50 mg cerebellum loaded 30 ug total protein

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TMEM47 Antibody (NBP2-32046) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM47 Products

Bioinformatics Tool for TMEM47 Antibody (NBP2-32046)

Discover related pathways, diseases and genes to TMEM47 Antibody (NBP2-32046). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM47 Antibody (NBP2-32046)

Discover more about diseases related to TMEM47 Antibody (NBP2-32046).
 

Pathways for TMEM47 Antibody (NBP2-32046)

View related products by pathway.

Blogs on TMEM47

There are no specific blogs for TMEM47, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Anonymous
09/19/2014
Application: WB
Species: Other

Bioinformatics

Gene Symbol TMEM47
Uniprot