TMEM176A Antibody

Western Blot: TMEM176A Antibody [NBP1-83283] - Analysis in control (vector only transfected HEK293T lysate) and TMEM176A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: TMEM176A Antibody [NBP1-83283] - Staining of human skeletal muscle shows no positivity in myocytes.

Immunohistochemistry-Paraffin: TMEM176A Antibody [NBP1-83283] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: TMEM176A Antibody [NBP1-83283] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: TMEM176A Antibody [NBP1-83283] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.

Product Discontinued

TMEM176A Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MGTADSDEMAPEAPQHTHIDVHIHQESALAKLLLTCCSALRPRATQAR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMEM176A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TMEM176A Antibody

• GS188
• HCA112Hepatocellular carcinoma-associated antigen 112
• likley ortholog of mouse GS188
• transmembrane protein 176A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMEM176A