TMEM106C Antibody - BSA Free

Western Blot: TMEM106C Antibody [NBP1-59829] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Product Discontinued

TMEM106C Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to TMEM106C(transmembrane protein 106C) The peptide sequence was selected from the middle region of TMEM106C. Peptide sequence NFYTVAVTSLSSQIQYMNTVVSTYVTTNVSLIPPRSEQLVNFTGKAEMGG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMEM106C
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TMEM106C Antibody - BSA Free

• EMOC
• Endoplasmic reticulum membrane protein overexpressed in cancer
• MGC111210
• MGC5576
• transmembrane protein 106C

Background

It belongs to TMEM106 family. The exact function of TMEM106C remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMEM106C Antibody (NBP1-59829)(1)

Publication using NBP1-59829

• Dukel M TMEM106C is overexpressed and modulates cell mobility in metastatic colon cancer cells Hacettepe Journal of Biology and Chemistry 2021-06-25 (WB, Human)

Bioinformatics

• Gene Symbol: TMEM106C
• Uniprot:
  • Q9BVX2(Human)