Recombinant Human TMEFF2/Tomoregulin-2 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human TMEFF2/Tomoregulin-2 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 201-292 of Human TMEFF2/Tomoregulin-2
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: SYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCD

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: TMEFF2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 35.86 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TMEFF2/Tomoregulin-2 GST (N-Term) Protein

• CT120.2
• HPP1member 2
• Hyperplastic polyposis protein 1
• TENB2
• TMEFF2
• Tomoregulin2
• Tomoregulin-2
• TPEFtomoregulin
• TR-2
• transmembrane protein TENB2
• transmembrane protein with EGF-like and two follistatin-like domains 2
• Transmembrane protein with EGF-like and two follistatin-like domains
• TRtomoregulin-2

Background

TMEFF2(transmembrane protein with EGF-like and two follistatin-like domains 2), a gene encoding a plasma membrane protein with two follistatin-like domains and one epidermal growth factor-like domain, had limited normal tissue distribution and was highly overexpressed in prostate cancer. The shedded form up-regulates cancer cell proliferation, probably by promoting ERK1/2 phosphorylation. Down-regulated in tumor cell lines in response to a high level of methylation in the 5' region. Clone J4B6, is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with a recombinant human TMEFF2 protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: TMEFF2