Recombinant Human TMEFF2/Tomoregulin-2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TMEFF2/Tomoregulin-2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 201-292 of Human TMEFF2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TMEFF2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TMEFF2/Tomoregulin-2 Protein

  • CT120.2
  • HPP1member 2
  • Hyperplastic polyposis protein 1
  • TENB2
  • TMEFF2
  • Tomoregulin2
  • Tomoregulin-2
  • TPEFtomoregulin
  • TR-2
  • transmembrane protein TENB2
  • transmembrane protein with EGF-like and two follistatin-like domains 2
  • Transmembrane protein with EGF-like and two follistatin-like domains
  • TRtomoregulin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-58922
Species: Hu
Applications: WB
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF2009
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for TMEFF2/Tomoregulin-2 Partial Recombinant Protein (H00023671-Q01) (0)

There are no publications for TMEFF2/Tomoregulin-2 Partial Recombinant Protein (H00023671-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEFF2/Tomoregulin-2 Partial Recombinant Protein (H00023671-Q01) (0)

There are no reviews for TMEFF2/Tomoregulin-2 Partial Recombinant Protein (H00023671-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEFF2/Tomoregulin-2 Partial Recombinant Protein (H00023671-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TMEFF2/Tomoregulin-2 Products

Bioinformatics Tool for TMEFF2/Tomoregulin-2 Partial Recombinant Protein (H00023671-Q01)

Discover related pathways, diseases and genes to TMEFF2/Tomoregulin-2 Partial Recombinant Protein (H00023671-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEFF2/Tomoregulin-2 Partial Recombinant Protein (H00023671-Q01)

Discover more about diseases related to TMEFF2/Tomoregulin-2 Partial Recombinant Protein (H00023671-Q01).
 

Pathways for TMEFF2/Tomoregulin-2 Partial Recombinant Protein (H00023671-Q01)

View related products by pathway.

PTMs for TMEFF2/Tomoregulin-2 Partial Recombinant Protein (H00023671-Q01)

Learn more about PTMs related to TMEFF2/Tomoregulin-2 Partial Recombinant Protein (H00023671-Q01).

Blogs on TMEFF2/Tomoregulin-2

There are no specific blogs for TMEFF2/Tomoregulin-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TMEFF2/Tomoregulin-2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEFF2
Entrez