TMEFF1/Tomoregulin-1 Antibody (1B1)

Images

 
Sandwich ELISA: TMEFF1/Tomoregulin-1 Antibody (1B1) [H00008577-M01] - Detection limit for recombinant GST tagged TMEFF1 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1B1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TMEFF1/Tomoregulin-1 Antibody (1B1) Summary

Immunogen
TMEFF1 (NP_003683 65 a.a. - 172 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SELNVRESDVRVCDESSCKYGGVCKEDGDGLKCACQFQCHTNYIPVCGSNGDTYQNECFLRRAACKHQKEITVIARGPCYSDNGSGSGEGEEEGSGAEVHRKHSKCGP
Specificity
Reacts with transmembrane protein with EGF-like and two follistatin-like domains 1.
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TMEFF1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TMEFF1/Tomoregulin-1 Antibody (1B1)

  • C9orf2
  • H7365member 1
  • TMEFF1
  • Tomoregulin1
  • Tomoregulin-1
  • TR-1
  • Transmembrane protein with EGF-like and one follistatin-like domain
  • transmembrane protein with EGF-like and two follistatin-like domains 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-12553
Species: Hu
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1477
Species: Mu
Applications: WB, IHC, Block

Publications for TMEFF1/Tomoregulin-1 Antibody (H00008577-M01) (0)

There are no publications for TMEFF1/Tomoregulin-1 Antibody (H00008577-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEFF1/Tomoregulin-1 Antibody (H00008577-M01) (0)

There are no reviews for TMEFF1/Tomoregulin-1 Antibody (H00008577-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEFF1/Tomoregulin-1 Antibody (H00008577-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEFF1/Tomoregulin-1 Products

Bioinformatics Tool for TMEFF1/Tomoregulin-1 Antibody (H00008577-M01)

Discover related pathways, diseases and genes to TMEFF1/Tomoregulin-1 Antibody (H00008577-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEFF1/Tomoregulin-1 Antibody (H00008577-M01)

Discover more about diseases related to TMEFF1/Tomoregulin-1 Antibody (H00008577-M01).
 

Pathways for TMEFF1/Tomoregulin-1 Antibody (H00008577-M01)

View related products by pathway.

PTMs for TMEFF1/Tomoregulin-1 Antibody (H00008577-M01)

Learn more about PTMs related to TMEFF1/Tomoregulin-1 Antibody (H00008577-M01).
 

Research Areas for TMEFF1/Tomoregulin-1 Antibody (H00008577-M01)

Find related products by research area.

Blogs on TMEFF1/Tomoregulin-1

There are no specific blogs for TMEFF1/Tomoregulin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEFF1/Tomoregulin-1 Antibody (1B1) and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEFF1
Entrez
Uniprot