![Immunohistochemistry-Paraffin: TMCC2 Antibody [NBP1-93797] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/TMCC2-Antibody-Immunohistochemistry-Paraffin-NBP1-93797-img0006.jpg "Immunohistochemistry-Paraffin: TMCC2 Antibody [NBP1-93797] - Staining of human liver shows no positivity in hepatocytes as expected.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AARALSGSATLVSSPKYGSDDECSSASASSAGAGSNSGAGPGGALGSPKSNALYGAPGNLDALLEELREIKEGQSHLEDSMEDLKTQLQRDYTYMTQCLQEER |
| Predicted Species | Mouse (97%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TMCC2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot E2F-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/E2F-2_AF5119_Western_Blot_5632.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TMCC2 |
![Immunohistochemistry-Paraffin: TMCC2 Antibody [NBP1-93797] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.](http://images.novusbio.com/fullsize/TMCC2-Antibody-Immunohistochemistry-Paraffin-NBP1-93797-img0002.jpg "Immunohistochemistry-Paraffin: TMCC2 Antibody [NBP1-93797] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.")
![Immunohistochemistry-Paraffin: TMCC2 Antibody [NBP1-93797] - Analysis in human bone marrow and liver tissues using NBP1-93797 antibody. Corresponding TMCC2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TMCC2-Antibody-Immunohistochemistry-Paraffin-NBP1-93797-img0003.jpg "Immunohistochemistry-Paraffin: TMCC2 Antibody [NBP1-93797] - Analysis in human bone marrow and liver tissues using NBP1-93797 antibody. Corresponding TMCC2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: TMCC2 Antibody [NBP1-93797] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.](http://images.novusbio.com/fullsize/TMCC2-Antibody-Immunohistochemistry-Paraffin-NBP1-93797-img0004.jpg "Immunohistochemistry-Paraffin: TMCC2 Antibody [NBP1-93797] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.")
![Immunohistochemistry-Paraffin: TMCC2 Antibody [NBP1-93797] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/TMCC2-Antibody-Immunohistochemistry-Paraffin-NBP1-93797-img0005.jpg "Immunohistochemistry-Paraffin: TMCC2 Antibody [NBP1-93797] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: TMCC2 Antibody [NBP1-93797] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/TMCC2-Antibody-Immunohistochemistry-Paraffin-NBP1-93797-img0007.jpg "Immunohistochemistry-Paraffin: TMCC2 Antibody [NBP1-93797] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.")
![Flow Cytometry Claudin-4 Antibody (382321) [Unconjugated]](https://images.novusbio.com/images2/Claudin4_MAB4219_Flow_Cytometry_21352.jpg)
![Immunohistochemistry Glycophorin A Antibody (R10) [Unconjugated]](https://images.novusbio.com/images2/Glycophorin_A_MAB1228_Immunohistochemistry_19187.jpg)
![Flow Cytometry Glycophorin A Antibody (R10) [Unconjugated]](https://images.novusbio.com/images2/Glycophorin_A_MAB1228_Flow_Cytometry_19288.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")