TM4SF1/L6 Recombinant Protein Antigen

Images

 
There are currently no images for TM4SF1/L6 Protein (NBP1-82854PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TM4SF1/L6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TM4SF1.

Source: E.coli

Amino Acid Sequence: GPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVSLFSI

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TM4SF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-82854.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for TM4SF1/L6 Recombinant Protein Antigen

  • L6
  • M3s1
  • M3S1Tumor-associated antigen L6
  • Membrane component chromosome 3 surface marker 1
  • membrane component, chromosome 3, surface marker 1
  • TAAL6
  • TAAL6H-L6
  • TM4SF1
  • transmembrane 4 L six family member 1
  • transmembrane 4 L6 family member 1
  • transmembrane 4 superfamily member 1

Background

The protein encoded by the TM4SF1 gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface antigen and is highly expressed in different carcinomas. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-31413
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
H00006124-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
H00058516-B02P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
291-G1
Species: Hu
Applications: BA
NBP2-38323
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-39113
Species: Hu, Mu, Rb, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
NBP2-45435
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-20214
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83192
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00029956-M01A
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP1-80104
Species: Hu
Applications: WB
NB100-2269
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
NBP3-05567
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-12793
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-88582
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for TM4SF1/L6 Protein (NBP1-82854PEP) (0)

There are no publications for TM4SF1/L6 Protein (NBP1-82854PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TM4SF1/L6 Protein (NBP1-82854PEP) (0)

There are no reviews for TM4SF1/L6 Protein (NBP1-82854PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TM4SF1/L6 Protein (NBP1-82854PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TM4SF1/L6 Products

Bioinformatics Tool for TM4SF1/L6 Protein (NBP1-82854PEP)

Discover related pathways, diseases and genes to TM4SF1/L6 Protein (NBP1-82854PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TM4SF1/L6 Protein (NBP1-82854PEP)

Discover more about diseases related to TM4SF1/L6 Protein (NBP1-82854PEP).
 

Pathways for TM4SF1/L6 Protein (NBP1-82854PEP)

View related products by pathway.

PTMs for TM4SF1/L6 Protein (NBP1-82854PEP)

Learn more about PTMs related to TM4SF1/L6 Protein (NBP1-82854PEP).
 

Research Areas for TM4SF1/L6 Protein (NBP1-82854PEP)

Find related products by research area.

Blogs on TM4SF1/L6

There are no specific blogs for TM4SF1/L6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TM4SF1/L6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TM4SF1