TJAP1 Antibody

Images

 
Western Blot: TJAP1 Antibody [NBP1-87273] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-581
Immunohistochemistry-Paraffin: TJAP1 Antibody [NBP1-87273] - Staining of human placenta shows strong cytoplasmic positivity with a granular pattern in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TJAP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GSPEEELPLPAFEKLNPYPTPSPPHPLYPGRRVIEFSEDKVRIPRNSPLPNCTYATRQAISLSLVEEGSERARPSPVPSTPASAQASPHHQPSPAPLTLSAP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TJAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TJAP1 Protein (NBP1-87273PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TJAP1 Antibody

  • DKFZp686F06131
  • PILTTJP4tight junction protein 4 (peripheral)
  • Protein incorporated later into tight junctions
  • tight junction associated protein 1 (peripheral)
  • Tight junction protein 4
  • tight junction-associated protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20183
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86594
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-48988
Species: Hu
Applications: IHC
NBP1-92410
Species: Hu
Applications: WB (-), ICC/IF, IHC, IHC-P
NBP1-88296
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13663
Species: Hu
Applications: IHC, IHC-P
NBP1-83587
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88331
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87273
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for TJAP1 Antibody (NBP1-87273) (0)

There are no publications for TJAP1 Antibody (NBP1-87273).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TJAP1 Antibody (NBP1-87273) (0)

There are no reviews for TJAP1 Antibody (NBP1-87273). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TJAP1 Antibody (NBP1-87273) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TJAP1 Products

Bioinformatics Tool for TJAP1 Antibody (NBP1-87273)

Discover related pathways, diseases and genes to TJAP1 Antibody (NBP1-87273). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TJAP1 Antibody (NBP1-87273)

Discover more about diseases related to TJAP1 Antibody (NBP1-87273).
 

Pathways for TJAP1 Antibody (NBP1-87273)

View related products by pathway.

Blogs on TJAP1

There are no specific blogs for TJAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TJAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TJAP1