TIP120B Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

TIP120B Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CAND2.
  
  

  Source: E. coli

  Amino Acid Sequence: MPVLVSGIIFSLADRSSSSTIRMDALAFLQGLLGTEPAEAFHPHLPILLPPVMACVADSFYKIAAEALVVLQELVRALWPLHRPRMLDPEPYVGEMSAVTLARLRATDLDQEVKERAISCMGH

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CAND2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33858.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TIP120B Recombinant Protein Antigen

• cullin-associated and neddylation-dissociated 2 (putative)
• Cullin-associated and neddylation-dissociated protein 2
• cullin-associated NEDD8-dissociated protein 2
• epididymis tissue protein Li 169
• KIAA0667TBP-interacting protein of 120 kDa B
• p120 CAND2
• TBP interacting protein
• TBP-interacting protein 120B
• TIP120BTp120b

Background

CAND2 is also known as TIP120B, and TATA-binding protein-interacting protein 120B. While both CAND1 (TIP120A) and CAND2 (TIP120B) are TATA-binding proteins and form complexes with various nuclear proteins involved in the control of eukaryotic gene transcription, CAND2 (TIP120B) is expressed specifically in muscle and heart tissue. This is contrary to the ubiquitous expression of CAND1 (TIP120A). TIP120 homologs exist in various higher eukaryotes including D. melanogaster, C. elegans, and A. thaliana. TIP120B is 60% identical in amino acid sequence to TIP120A.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CAND2