Recombinant Human TIMM17B GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human TIMM17B GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-172 of Human TIMM17B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
TIMM17B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
44.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TIMM17B GST (N-Term) Protein

  • inner mitochondrial membrane preprotein translocase
  • JM3
  • mitochondrial import inner membrane translocase subunit Tim17-B
  • TIM17BDXS9822
  • translocase of inner mitochondrial membrane 17 homolog B (yeast)

Background

The TIMM17B gene encodes a protein that is part of the mitochondrial transport TIMM23 complex. TIM translocase complexes facilitate the transport of mitochondrial proteins from the cytosol across the mitochondrial inner membrane and into the mitochondrion. Two a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86941
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-80681
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB100-39002
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
H00004340-B01P
Species: Hu, Rt
Applications: WB
NBP1-54618
Species: Hu
Applications: WB
MAB7906
Species: Hu
Applications: IHC, Simple Western, WB
NBP3-16628
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-41398
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-84331
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00010431-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-31470
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB100-40853
Species: Hu
Applications: IHC, IHC-P, IP, WB
NB600-408
Species: Bv, Hu, Mu, Po, Rb, Rt
Applications: ELISA, FLISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, MiAr, PAGE, WB
NBP2-67817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-2559
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-92856
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for TIMM17B Recombinant Protein (H00010245-P01) (0)

There are no publications for TIMM17B Recombinant Protein (H00010245-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIMM17B Recombinant Protein (H00010245-P01) (0)

There are no reviews for TIMM17B Recombinant Protein (H00010245-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TIMM17B Recombinant Protein (H00010245-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TIMM17B Products

Bioinformatics Tool for TIMM17B Recombinant Protein (H00010245-P01)

Discover related pathways, diseases and genes to TIMM17B Recombinant Protein (H00010245-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TIMM17B

There are no specific blogs for TIMM17B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Collagen I Antibody
NB600-408-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TIMM17B GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TIMM17B