Thrombospondin-3 Recombinant Protein Antigen

Images

 
There are currently no images for Thrombospondin-3 Recombinant Protein Antigen (NBP2-68953PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Thrombospondin-3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Thrombospondin-3.

Source: E. coli

Amino Acid Sequence: VGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
THBS3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68953.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Thrombospondin-3 Recombinant Protein Antigen

  • MGC119565
  • THBS3
  • thrombospondin 3
  • Thrombospondin3
  • Thrombospondin-3
  • TSP3
  • TSP3MGC119564

Background

THBS3 is a gene that codes for an adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions and has two isoforms, with lengths of 956 and 836 amino acids and weights of approximately 104 and 91 kDa respectively. Current research is being done on diseases and disorders related to this gene including osteosarcoma, lung cancer, breast cancer, retinitis, malaria, neuronitis, and echinococcosis. THBS3 has also been shown to have interactions with THBS2, THBS1, THBS4, FURIN, and PDGFB in pathways such as the focal adhesion, inflammatory response, signal transduction, signaling by PDGF, phagosome, ECM-receptor interaction, and malaria pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DTSP10
Species: Hu
Applications: ELISA
DCMP0
Species: Hu
Applications: ELISA
DTSP20
Species: Hu
Applications: ELISA
NBP1-87741
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF2390
Species: Hu
Applications: Simple Western, WB
NBP2-24582
Species: Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP1-52012
Species: Ca, Hu, Po
Applications: IHC,  IHC-P, PEP-ELISA, WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P
AF942
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
NB300-619
Species: Bv, Ch, Ha, Hu, Mu, Rt
Applications: ICC, ICC/IF, IHC,  IHC-P, IP, WB
3047-CC
Species: Hu
Applications: BA
DPSG10
Species: Hu
Applications: ELISA
NB600-233
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC,  IHC-P, IP, WB
AF8216
Species: Hu, Mu, Rt
Applications: WB

Publications for Thrombospondin-3 Recombinant Protein Antigen (NBP2-68953PEP) (0)

There are no publications for Thrombospondin-3 Recombinant Protein Antigen (NBP2-68953PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Thrombospondin-3 Recombinant Protein Antigen (NBP2-68953PEP) (0)

There are no reviews for Thrombospondin-3 Recombinant Protein Antigen (NBP2-68953PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Thrombospondin-3 Recombinant Protein Antigen (NBP2-68953PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Thrombospondin-3 Products

Research Areas for Thrombospondin-3 Recombinant Protein Antigen (NBP2-68953PEP)

Find related products by research area.

Blogs on Thrombospondin-3

There are no specific blogs for Thrombospondin-3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Thrombospondin-3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol THBS3