THOC3 Antibody

Images

 
Western Blot: THOC3 Antibody [NBP1-57297] - Human Spleen lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

THOC3 Antibody Summary

Immunogen
Synthetic peptides corresponding to THOC3(THO complex 3) The peptide sequence was selected from the middle region of THOC3. Peptide sequence LWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPND.
Specificity
This product is specific to Subunit or Isofrom: 3.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
THOC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against THOC3 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for THOC3 Antibody

  • hTREX45
  • MGC5469
  • TEX1 homolog
  • TEX1THO complex subunit 3
  • THO complex 3
  • tho3

Background

THOC3 is part of the TREX (transcription/export) complex, which includes THO2, HPR1, ALY, and UAP56.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89670
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
7570-GH
Species: Hu
NBP1-91788
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-33598
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB7555
Species: Hu
Applications: WB, Simple Western
NBP1-92500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52455
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-02559
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00060436-M01
Species: Hu
Applications: WB, ELISA
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-86320
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB
NBP2-33286
Species: Hu
Applications: IHC, IHC-P
NBP1-19160
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57297
Species: Hu
Applications: WB

Publications for THOC3 Antibody (NBP1-57297) (0)

There are no publications for THOC3 Antibody (NBP1-57297).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for THOC3 Antibody (NBP1-57297) (0)

There are no reviews for THOC3 Antibody (NBP1-57297). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for THOC3 Antibody (NBP1-57297) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional THOC3 Products

Bioinformatics Tool for THOC3 Antibody (NBP1-57297)

Discover related pathways, diseases and genes to THOC3 Antibody (NBP1-57297). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for THOC3 Antibody (NBP1-57297)

View related products by pathway.

Research Areas for THOC3 Antibody (NBP1-57297)

Find related products by research area.

Blogs on THOC3

There are no specific blogs for THOC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our THOC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol THOC3
Uniprot