TFIIS Antibody

Images

 
Western Blot: TFIIS Antibody [NBP3-10411] - Western blot analysis of TFIIS in Rat Spleen lysates. Antibody dilution at 1.0ug/ml

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TFIIS Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Rat TFIIS (NP_476439). Peptide sequence SVNALRKQSSDEELIALAKSLIKSWKKLLDVSDGKSRDQGRGTPLPTSSS
Clonality
Polyclonal
Host
Rabbit
Gene
TCEA2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for TFIIS Antibody

  • Testis-specific S-II
  • TFIIS
  • transcription elongation factor A (SII), 2
  • transcription elongation factor A protein 2
  • Transcription elongation factor S-II protein 2
  • transcription elongation factor TFIIS.1
  • Transcription elongation factor TFIIS.l

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-17971
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
NBP3-17973
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-03839
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-32622
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83508
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92344
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-273
Species: Hu, Mu
Applications: IP, WB
NB100-2582
Species: Ch, Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, KD, WB
NBP2-94643
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00051728-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
H00006827-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-45519
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-49349
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-16019
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-62629
Species: Hu
Applications: IHC, IHC-P
NBP1-47801
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for TFIIS Antibody (NBP3-10411) (0)

There are no publications for TFIIS Antibody (NBP3-10411).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TFIIS Antibody (NBP3-10411) (0)

There are no reviews for TFIIS Antibody (NBP3-10411). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TFIIS Antibody (NBP3-10411) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TFIIS Products

Bioinformatics Tool for TFIIS Antibody (NBP3-10411)

Discover related pathways, diseases and genes to TFIIS Antibody (NBP3-10411). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TFIIS Antibody (NBP3-10411)

Discover more about diseases related to TFIIS Antibody (NBP3-10411).
 

Pathways for TFIIS Antibody (NBP3-10411)

View related products by pathway.

PTMs for TFIIS Antibody (NBP3-10411)

Learn more about PTMs related to TFIIS Antibody (NBP3-10411).

Blogs on TFIIS

There are no specific blogs for TFIIS, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TFIIS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TCEA2