TFF2 Antibody

Images

 
Western Blot: TFF2 Antibody [H00007032-D01P] - Analysis of TFF2 expression in transfected 293T cell line by TFF2 polyclonal antibody.Lane 1: TFF2 transfected lysate(14.30 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TFF2 Antibody Summary

Immunogen
TFF2 (NP_005414.1, 1 a.a. - 129 a.a.) full-length human protein. MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TFF2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TFF2 Antibody

  • SML1
  • SML1trefoil factor 2, SML1, human spasmolytic polypeptide (SP)10spasmolytic protein 1
  • SP
  • Spasmolysin
  • Spasmolytic Polypeptide
  • TFF2
  • trefoil factor 2

Background

Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. The encoded protein inhibits gastric acid secretion. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NB300-119
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
AF4256
Species: Hu
Applications: WB
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00007032-D01P
Species: Hu
Applications: WB

Publications for Trefoil Factor 2/SML1 Antibody (H00007032-D01P) (0)

There are no publications for Trefoil Factor 2/SML1 Antibody (H00007032-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Trefoil Factor 2/SML1 Antibody (H00007032-D01P) (0)

There are no reviews for Trefoil Factor 2/SML1 Antibody (H00007032-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Trefoil Factor 2/SML1 Antibody (H00007032-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TFF2 Products

Bioinformatics Tool for Trefoil Factor 2/SML1 Antibody (H00007032-D01P)

Discover related pathways, diseases and genes to Trefoil Factor 2/SML1 Antibody (H00007032-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Trefoil Factor 2/SML1 Antibody (H00007032-D01P)

Discover more about diseases related to Trefoil Factor 2/SML1 Antibody (H00007032-D01P).
 

Pathways for Trefoil Factor 2/SML1 Antibody (H00007032-D01P)

View related products by pathway.

PTMs for Trefoil Factor 2/SML1 Antibody (H00007032-D01P)

Learn more about PTMs related to Trefoil Factor 2/SML1 Antibody (H00007032-D01P).

Blogs on TFF2

There are no specific blogs for TFF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TFF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TFF2
Entrez
Uniprot