Recombinant Human TFEC Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TFEC Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-197 of Human TFEC full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTLDHQIINPTLKWSQPAVPSGGPLVQHAHTTLDSDAGLTENPLTKLLAIGKEDDNAQWHLSGSILDVYSGEQGISPINMGLTSASCPSSLPMKREITETDTRALAKERQKKDNHNLIERRRRYNINYRIKELGTLIPKSNDPDMRWNKGTILKASVEYIKWLQKEQQRARELEHRQKKLEQANRRLLLRIQVFIRM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TFEC

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TFEC Protein

  • Class E basic helix-loop-helix protein 34
  • hTFEC-L
  • TCFECTFECLbHLHe34BHLHE34
  • TFE-C
  • transcription factor EC
  • Transcription factor EC-like

Background

TFEC( AAH29891, 1 a.a. - 198 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NBP1-89976
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-1030
Species: Hu
Applications: WB, ChIP, PEP-ELISA
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001513-M01
Species: Hu
Applications: WB, ELISA, IHC-P
AF7817
Species: Hu, Mu, Rt
Applications: WB
H00338917-T01
Species: Hu
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
MAB381
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
H00022797-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for TFEC Recombinant Protein (H00022797-P01) (0)

There are no publications for TFEC Recombinant Protein (H00022797-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TFEC Recombinant Protein (H00022797-P01) (0)

There are no reviews for TFEC Recombinant Protein (H00022797-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TFEC Recombinant Protein (H00022797-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TFEC Products

Bioinformatics Tool for TFEC Recombinant Protein (H00022797-P01)

Discover related pathways, diseases and genes to TFEC Recombinant Protein (H00022797-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TFEC Recombinant Protein (H00022797-P01)

Discover more about diseases related to TFEC Recombinant Protein (H00022797-P01).
 

Pathways for TFEC Recombinant Protein (H00022797-P01)

View related products by pathway.

PTMs for TFEC Recombinant Protein (H00022797-P01)

Learn more about PTMs related to TFEC Recombinant Protein (H00022797-P01).

Blogs on TFEC

There are no specific blogs for TFEC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF
TFEC Antibody
NBP2-43766

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TFEC Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TFEC