TEX2 Antibody

Images

 
Western Blot: TEX2 Antibody [NBP1-59977] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: TEX2 Antibody [NBP1-59977] - Human HepG2, Antibody Dilution: 1.0 ug/ml TEX2 is supported by BioGPS gene expression data to be expressed in HepG2.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TEX2 Antibody Summary

Immunogen
Synthetic peptides corresponding to TEX2(testis expressed 2) The peptide sequence was selected from the N terminal of TEX2. Peptide sequence KSLSTEVEPKESPHPARHRHLMKTLVKSLSTDTSRQESDTVSYKPPDSKL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TEX2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TEX2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TEX2 Antibody

  • HT008
  • KIAA1738DKFZp781G0721
  • testis expressed 2
  • testis expressed sequence 2
  • testis-expressed sequence 2 protein
  • TMEM96
  • transmembrane protein 96

Background

TEX2 is a multi-pass membrane protein. The exact function of TEX2 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13798
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
NBP2-46538
Species: Hu
Applications: WB, IHC
H00005018-D01P
Species: Hu
Applications: WB, ICC/IF
NBP2-05096
Species: Hu
NBP1-69668
Species: Hu
Applications: WB
NBP2-07087
Species: Hu
NBP2-34075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB8508
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-22523
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00009572-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88975
Species: Hu
Applications: IHC, IHC-P
NB100-2131
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-20385
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-31881
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59977
Species: Hu
Applications: WB

Publications for TEX2 Antibody (NBP1-59977) (0)

There are no publications for TEX2 Antibody (NBP1-59977).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEX2 Antibody (NBP1-59977) (0)

There are no reviews for TEX2 Antibody (NBP1-59977). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TEX2 Antibody (NBP1-59977) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TEX2 Products

Bioinformatics Tool for TEX2 Antibody (NBP1-59977)

Discover related pathways, diseases and genes to TEX2 Antibody (NBP1-59977). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TEX2 Antibody (NBP1-59977)

Discover more about diseases related to TEX2 Antibody (NBP1-59977).
 

Pathways for TEX2 Antibody (NBP1-59977)

View related products by pathway.

Blogs on TEX2

There are no specific blogs for TEX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TEX2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TEX2
Uniprot