PDZD8 Antibody

Images

 
Immunohistochemistry-Paraffin: PDZD8 Antibody [NBP1-88975] - Staining of human appendix shows strong cytoplasmic positivity in granular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDZD8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SCLFDIEACHRYLNIALWCRDPFKLGGLICLGHVSLKLEDVALGCLATSNTEYLSKLRLEAPSPKAIVTRTALRNLSMQKGFNDKFCYGDITIHFKYLKEGESDHHVVTNVEKEKEPHLVEEVSVLPKEEQFVGQMGLTENKHSFQDTQF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDZD8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PDZD8 Protein (NBP1-88975PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDZD8 Antibody

  • bA129M16.2
  • FLJ25412
  • FLJ34427
  • PDZ domain containing 8
  • PDZ domain-containing protein 8
  • PDZK8
  • sarcoma antigen NY-SAR-104
  • sarcoma antigen NY-SAR-84
  • Sarcoma antigen NY-SAR-84/NY-SAR-104

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32875
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-86267
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19562
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83156
Species: Hu
Applications: Flow, IHC, IHC-P
NBP1-94014
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PDZD8 Antibody (NBP1-88975) (0)

There are no publications for PDZD8 Antibody (NBP1-88975).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDZD8 Antibody (NBP1-88975) (0)

There are no reviews for PDZD8 Antibody (NBP1-88975). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PDZD8 Antibody (NBP1-88975) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDZD8 Products

Bioinformatics Tool for PDZD8 Antibody (NBP1-88975)

Discover related pathways, diseases and genes to PDZD8 Antibody (NBP1-88975). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDZD8 Antibody (NBP1-88975)

Discover more about diseases related to PDZD8 Antibody (NBP1-88975).
 

Pathways for PDZD8 Antibody (NBP1-88975)

View related products by pathway.

Research Areas for PDZD8 Antibody (NBP1-88975)

Find related products by research area.

Blogs on PDZD8

There are no specific blogs for PDZD8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDZD8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDZD8