TECPR1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TECPR1 Antibody [NBP1-84206] - Staining of human cell line HEK 293 shows localization to vesicles.
Immunohistochemistry-Paraffin: TECPR1 Antibody [NBP1-84206] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TECPR1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YWEMCKDSQLEFKRVSATTQCCWGIACDNQVYVYVCASDVPIRRREEAYENQRWNPMGGFCEKLLLSDRWGWSDVSGLQHRPLDRVALPSPHWEWESDWYVDENF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TECPR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TECPR1 Protein (NBP1-84206PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TECPR1 Antibody

  • DKFZP434B0335
  • FLJ23419
  • FLJ90593
  • KIAA1358
  • tectonin beta-propeller repeat containing 1
  • tectonin beta-propeller repeat-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP1-88878
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88879
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
NBP2-15501
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85091
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84206
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for TECPR1 Antibody (NBP1-84206) (0)

There are no publications for TECPR1 Antibody (NBP1-84206).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TECPR1 Antibody (NBP1-84206) (0)

There are no reviews for TECPR1 Antibody (NBP1-84206). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TECPR1 Antibody (NBP1-84206) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TECPR1 Products

Bioinformatics Tool for TECPR1 Antibody (NBP1-84206)

Discover related pathways, diseases and genes to TECPR1 Antibody (NBP1-84206). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TECPR1 Antibody (NBP1-84206)

Discover more about diseases related to TECPR1 Antibody (NBP1-84206).
 

Pathways for TECPR1 Antibody (NBP1-84206)

View related products by pathway.

Blogs on TECPR1

There are no specific blogs for TECPR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TECPR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TECPR1