Recombinant Human TEAD4 Protein

Images

 
SDS-Page: Recombinant Human TEAD4 Protein [H00007004-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TEAD4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-361 of Human TEAD4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TEAD4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TEAD4 Protein

  • EFTR-2
  • hRTEF-1B
  • related transcription enhancer factor 1B
  • RTEF1RTEF-1
  • TCF13L1MGC9014
  • TEA domain family member 4TEF3
  • TEAD-4
  • TEF-3
  • TEFR-1
  • Transcription factor 13-like 1
  • Transcription factor RTEF-1
  • transcriptional enhancer factor 1-related
  • transcriptional enhancer factor 3
  • transcriptional enhancer factor TEF-3

Background

TEAD4( AAH15497, 1 a.a. - 362 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB100-2136
Species: Hu
Applications: IHC, IHC-P, IP
NBP2-55789
Species: Hu
Applications: WB, ICC/IF
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
H00010413-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-83949
Species: Hu
Applications: IHC, IHC-P
H00007008-T01
Species: Hu
NBP1-81763
Species: Hu
Applications: IHC, IHC-P
NBP1-46852
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF1997
Species: Hu
Applications: WB, ChIP, ICC
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TEAD4 Recombinant Protein (H00007004-P01) (0)

There are no publications for TEAD4 Recombinant Protein (H00007004-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEAD4 Recombinant Protein (H00007004-P01) (0)

There are no reviews for TEAD4 Recombinant Protein (H00007004-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TEAD4 Recombinant Protein (H00007004-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TEAD4 Products

Bioinformatics Tool for TEAD4 Recombinant Protein (H00007004-P01)

Discover related pathways, diseases and genes to TEAD4 Recombinant Protein (H00007004-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TEAD4 Recombinant Protein (H00007004-P01)

Discover more about diseases related to TEAD4 Recombinant Protein (H00007004-P01).
 

Pathways for TEAD4 Recombinant Protein (H00007004-P01)

View related products by pathway.

PTMs for TEAD4 Recombinant Protein (H00007004-P01)

Learn more about PTMs related to TEAD4 Recombinant Protein (H00007004-P01).
 

Research Areas for TEAD4 Recombinant Protein (H00007004-P01)

Find related products by research area.

Blogs on TEAD4

There are no specific blogs for TEAD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TEAD4 Antibody (5H3)
H00007004-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TEAD4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TEAD4