TEAD3 Antibody (1C4) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: TEAD3 Antibody (1C4) [H00007005-M01] - Analysis of monoclonal antibody to TEAD3 on HeLa cell . Antibody concentration 10 ug/ml.

ELISA: TEAD3 Antibody (1C4) [H00007005-M01] - Detection limit for recombinant GST tagged TEAD3 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA, ICC/IF
• Clone: 1C4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TEAD3 Antibody (1C4) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: TEAD3 (NP_003205, 215 a.a. ~ 302 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWAD
• Specificity: TEAD3 (1C4)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TEAD3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
• Application Notes: Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TEAD3 Antibody (1C4) - Azide and BSA Free

• DTEF-1
• ETFR-1
• TEA domain family member 3TEAD-3
• TEAD5TEF5TEA domain family member 5
• TEF-5
• transcriptional enhancer factor 5
• Transcriptional enhancer factor TEF-5 (DTEF-1)
• transcriptional enhancer factor TEF-5

Background

This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is predominantly expressed in the placenta and is involved in the transactivation of the chorionic somatomammotropin-B gene enhancer. Translation of this protein is initiated at a non-AUG (AUA) start codon.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TEAD3
• Entrez:
  • 7005(Human)
• OMIM:
  • 603170(Human)
• Uniprot:
  • NP_003205(Human)