TDAG8/GPR65 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TDAG8/GPR65 Antibody [NBP2-58485] - Staining of human cell line RH-30 shows localization to cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TDAG8/GPR65 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ETGRYDMWNILKFCTGRCNTSQRQRKRILSVSTKDTMELEV
Specificity
Specificity of human TDAG8/GPR65 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPR65
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TDAG8/GPR65 Recombinant Protein Antigen (NBP2-58485PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TDAG8/GPR65 Antibody

  • G protein-coupled receptor 65
  • GPR65
  • G-protein coupled receptor 65
  • Psychosine Receptor
  • T-cell death-associated gene 8 protein
  • TDAG8
  • TDAG8hTDAG8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS1194
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Pm, Pm, Rb
Applications: ICC/IF, IHC, IHC-P
NLS145
Species: Hu, Ca, Pm, Pm
Applications: ICC/IF, IHC, IHC-P
NBP2-69090
Species: Hu, Mu, Pm
Applications: WB, ELISA, ICC/IF
NLS418
Species: Hu
Applications: IHC, IHC-P
NLS2756
Species: Hu, Pm
Applications: IHC, IHC-P, ICC
NLS442
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P
NLS2272
Species: Hu, Pm, Pm
Applications: IHC, IHC-P
NBP1-84903
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
AF194
Species: Mu
Applications: WB, IHC
NLS2576
Species: Hu, Rt, Pm
Applications: IHC, IHC-P
NBP2-73621
Species: Hu
Applications: Flow, ICC/IF, CyTOF-ready
NB100-93444
Species: Hu
Applications: WB, PEP-ELISA
NB100-56104
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-Fr, IHC-P, IP

Publications for TDAG8/GPR65 Antibody (NBP2-58485) (0)

There are no publications for TDAG8/GPR65 Antibody (NBP2-58485).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TDAG8/GPR65 Antibody (NBP2-58485) (0)

There are no reviews for TDAG8/GPR65 Antibody (NBP2-58485). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TDAG8/GPR65 Antibody (NBP2-58485) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TDAG8/GPR65 Products

Bioinformatics Tool for TDAG8/GPR65 Antibody (NBP2-58485)

Discover related pathways, diseases and genes to TDAG8/GPR65 Antibody (NBP2-58485). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TDAG8/GPR65 Antibody (NBP2-58485)

Discover more about diseases related to TDAG8/GPR65 Antibody (NBP2-58485).
 

Pathways for TDAG8/GPR65 Antibody (NBP2-58485)

View related products by pathway.

Research Areas for TDAG8/GPR65 Antibody (NBP2-58485)

Find related products by research area.

Blogs on TDAG8/GPR65

There are no specific blogs for TDAG8/GPR65, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TDAG8/GPR65 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR65