TDAG8/GPR65 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit TDAG8/GPR65 Antibody - BSA Free (NBP2-58485) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ETGRYDMWNILKFCTGRCNTSQRQRKRILSVSTKDTMELEV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GPR65 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TDAG8/GPR65 Antibody - BSA Free
Background
GPR65 (TDAG8), a Lysophospholipid/Lysosphingolipid Receptor, is a molecular target for psychosine, a toxic lipid formed by the breakdown of galactosylceramide (cerebroside). A build-up of psychosine, caused by the lack of galactosylceramidase, results in the death of the myelin-synthesizing cells, oligodendrocytes, which is associated with Krabbe disease. GPR65 has been reported in human in peripheral blood leukocytes, spleen, lymph node, and thymus. ESTs have been isolated from human B-cell/lung/testis, brain/lung/testis, pancreas/spleen, lung/spleen, leukocyte, embryo, kidney, liver/spleen, thyroid, and vessel libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Eq, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: IHC, IHC-P
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: EnzAct
Species: Hu
Applications: PEP-ELISA, WB
Species: Mu
Applications: ELISA
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF
Publications for TDAG8/GPR65 Antibody (NBP2-58485) (0)
There are no publications for TDAG8/GPR65 Antibody (NBP2-58485).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TDAG8/GPR65 Antibody (NBP2-58485) (0)
There are no reviews for TDAG8/GPR65 Antibody (NBP2-58485).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TDAG8/GPR65 Antibody (NBP2-58485) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TDAG8/GPR65 Products
Research Areas for TDAG8/GPR65 Antibody (NBP2-58485)
Find related products by research area.
|
Blogs on TDAG8/GPR65