TCP1-beta Recombinant Protein Antigen

Images

 
There are currently no images for TCP1-beta Protein (NBP1-88147PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TCP1-beta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CCT2.

Source: E. coli

Amino Acid Sequence: DALCVLAQTVKDSRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDMREGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CCT2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88147.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TCP1-beta Recombinant Protein Antigen

  • Cctb
  • CCT-beta
  • CCTBPRO1633,99D8.1
  • chaperonin containing t-complex polypeptide 1, beta subunit
  • chaperonin containing t-complex polypeptide 1, subunit 2
  • chaperonin containing TCP1, subunit 2 (beta)
  • MGC142074
  • MGC142076
  • T-complex protein 1 subunit beta
  • T-complex protein 1, beta subunit
  • TCP-1-beta

Background

TCP1-beta encodes a molecular chaperone that is member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of the gene described in this record have been observed but have not been thoroughly characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006950-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-38284
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-88144
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-83042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-46715
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-79040
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP1-77397
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NB120-6106
Species: Am, Bv, Ch, Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, Simple Western, WB
NBP1-49532
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP1-89766
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-31851
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-97692
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP1-47801
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-88147PEP
Species: Hu
Applications: AC

Publications for TCP1-beta Protein (NBP1-88147PEP) (0)

There are no publications for TCP1-beta Protein (NBP1-88147PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCP1-beta Protein (NBP1-88147PEP) (0)

There are no reviews for TCP1-beta Protein (NBP1-88147PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TCP1-beta Protein (NBP1-88147PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TCP1-beta Products

Research Areas for TCP1-beta Protein (NBP1-88147PEP)

Find related products by research area.

Blogs on TCP1-beta

There are no specific blogs for TCP1-beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TCP1-beta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CCT2